KEGG   Aspergillus fumigatus: AFUA_3G00470Help
Entry
AFUA_3G00470      CDS       T01017                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 313 aa AA seqDB search
MISISSLSFGLAAIAGAYALPSDKSVSLAERQTITTSQTGTNNGYYYSFWTNGAGSVQYT
NGAGGEYSVTWANQNGGDFTCGKGWNPGSDHDITFSGSFNPSGNAYLSVYGWTTNPLVEY
YILENYGSYNPGSGMTHKGTVTSDGSTYDIYEHQQVNQPSIVGTATFNQYWSIRQNKRSS
GTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITVSSGGSSSGGSGGSSSTTS
SGSSPTGGSGSVSLLPYGCGFMCILTVIVLCFVGPVRWNWLVWSYLLLFGHLPGFELVLL
PVLVVPSCRVISK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatctccatttcctcgctcagctttggactcgccgctatcgccggcgcatatgctctt
ccgagtgacaaatccgtcagcttagcggaacgtcagacgatcacgaccagccagacaggc
acaaacaatggctactactattccttctggaccaacggtgccggatcagtgcaatataca
aatggtgctggtggcgaatatagtgtgacgtgggcgaaccagaacggtggtgactttacc
tgtgggaagggctggaatccagggagtgaccatgacattaccttctctggcagcttcaat
ccttccggaaatgcttacctgtccgtgtatggatggactaccaaccccctagtcgaatac
tacatcctcgagaactatggcagttacaatcctggctcgggcatgacgcacaagggcacc
gtcaccagcgatggatccacctacgacatctatgagcaccaacaggtcaaccagccttcg
atcgtcggcacggccaccttcaaccaatactggtccatccgccaaaacaagcgatccagc
ggcacagtcaccaccgcgaatcacttcaaggcctgggctagtctggggatgaacctgggt
acccataactatcagattgtttccactgagggatatgagagcagcggtacctcgaccatc
actgtctcgtctggtggttcttcttctggtggaagtggtggcagctcgtctactacttcc
tcaggcagctcccctactggtggctccggcagtgtaagtcttcttccatatggttgtggc
tttatgtgtattctgactgtgatagtgctctgctttgtggggccagtgcggtggaattgg
ctggtctggtcctacttgctgctcttcgggcacttgccaggtttcgaactcgtactactc
ccagtgcttgtagtaccttcttgcagggttatatccaagtga

DBGET integrated database retrieval system