KEGG   Aspergillus fumigatus: AFUA_3G01070Help
Entry
AFUA_3G01070      CDS       T01017                                 

Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00350  Tyrosine metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFUA_3G01070
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AFUA_3G01070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-GeneID: 3505901
NCBI-ProteinID: XP_748428
UniProt: Q4WFT7
Position
3
AA seq 383 aa AA seqDB search
MRFTILSTIAALAAVAPTAAFSIDQWDVLAGKALVNQVLYHFSNPDASKSCTPLTATVRR
EWGSLSKRERKEYTDAVLCLASKPSKLDPAFAPGARSRYDDFVAVHINQTWVIHGTGNFL
TWHRYFTWAYEQALRNECGYTGYQPYWAWNKYADDPRNSPIFDGSDYSMSGDGSYIPHDG
SEAAPGIVLTPGNGGGCVFSGPFKNFTVNLGPVFPSLKVPGIVAQNGSGLDYNPRCLRRD
ISEDAASWTTTEHVLDLIEKQNNILDFQNRMQGDFPNGFLGVHSGGHYTIGGDPGGDFFV
SPGDPAFYLHHAAIDRVFWTWQNQDPKSRTYVVAGQTILPSLVPDAPNATLDDIVDMGSA
LAPPQTIRQLLDTTGGPFCYVYL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttacaatcctctccacaattgctgctttggctgcagttgcgcccactgcggct
ttcagcattgaccagtgggatgtccttgctgggaaggctcttgtcaatcaggttctctat
cacttctccaacccggatgccagcaagtcatgcacccctcttaccgcaacggtccgccga
gaatggggctctctctcgaaacgcgaacgcaaagagtacaccgacgcagtgctgtgtctc
gcttctaagccttcgaaactggatccggcatttgctcctggcgcgcgctctcgctacgat
gactttgttgctgtccatatcaaccagacatgggttatccacggcaccggcaactttctg
acatggcaccgttacttcacctgggcctatgagcaagccctccgcaacgaatgcggttac
acgggctaccagccatactgggcctggaacaagtatgccgatgacccgcgcaactctccc
atatttgatggctcggattacagtatgtccggcgacggatcatacattccgcacgacggt
tccgaggctgctcccggtattgtcctaactcctggaaacggaggtggctgtgtcttctcc
ggcccgttcaaaaacttcactgtcaacctcggccctgtcttccccagtctcaaggtccca
ggaatcgtcgctcagaacggctccggactggactacaacccccgctgtctccgccgtgat
atctccgaggacgcagcgagctggacaacaaccgagcacgtacttgacctgatcgagaag
cagaacaacatccttgacttccagaataggatgcagggtgacttccctaatggcttcctg
ggcgtccacagcggcggccactataccattggcggtgatcctggcggtgatttcttcgtt
tcccccggtgaccctgctttctacctccaccacgccgccatcgaccgtgtcttctggacg
tggcagaatcaggaccccaagtcgcggacgtatgtcgtggcaggacagaccatccttccc
agtctggtgccagatgcgcccaatgctactctggatgatatcgtcgatatgggcagtgcg
ctggctccgccgcagactatccggcagctgttggatacgacgggtgggccattctgttat
gtttatctgtga

DBGET integrated database retrieval system