KEGG   Aspergillus fumigatus: AFUA_3G03870Help
Entry
AFUA_3G03870      CDS       T01017                                 

Definition
(RefSeq) endo-1,4-beta-glucanase
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 342 aa AA seqDB search
MRHVQSTQLLAALLLTTRVTAHGHVTNIVINGVSYRGWNIDSDPYNPDPPVVVAWQTPNT
ANGFISPDAYGTNDIICHLNATNARGHAVVAAGDKISIQWTAWPDSHHGPVIDYLARCGS
SCETVDKTTLEFFKIDGVGLVDGSNPPGVWGDDQLIADNNSWLVEIPPTIAPGYYVLRHE
LIALHGAGSQNGAQNYPQCFNLQITGSGTAQPSGVKGTELYSPTDPGILVNIYNALSTYI
VPGPTLIPGAVSVVQSSSTITASGTPVTGSGSAPTTSATTTLSTTTRATTTTTTTTAGSS
TSVQSVYGQCGGSGWSGPTACVTGATCTSYNSYYSQCIPTAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgttcaatctacgcagctgcttgcagcgcttctcctcactacccgcgtcaca
gctcatggtcatgttacaaacatcgtaatcaacggggtttcgtaccgcggatggaatatt
gattcggatccctacaatcctgatccgccggtggtggtagcgtggcagacccccaacacg
gcgaatggcttcatctccccagatgcgtatggaacgaacgatatcatctgtcatctcaac
gccaccaacgcgcgagggcatgctgtggttgcggcgggcgacaaaatatccattcaatgg
accgcttggccagattcccaccatggaccagtcatcgactacctggcgaggtgcggttcg
agctgcgagacggtagacaagacgactctggagttcttcaagatcgatggtgttgggctg
gtggacggctcaaacccaccgggggtctggggtgacgatcagttgatcgcggataacaac
tcgtggctggtggagatccctccgaccattgccccgggctattatgttcttcgacatgag
ttgattgcgttgcatggagccggcagccagaatggagcccagaactacccccaatgtttt
aaccttcagattacagggtcggggaccgcgcagccctcgggtgtgaagggcacagagctc
tattcacccacagatccgggcattctggtcaatatctataacgcgctttcgacgtatata
gtgccgggtcccacgctcattcccggggctgtgtcagttgtgcagtccagttcgaccatc
actgcgtcgggaacgccggtaactggcagtggtagtgctccgactaccagtgccactaca
acgctgtccacgacaaccagggccaccacgaccacaactacgaccacggcgggcagctcg
acttcagttcaatcggtctacgggcagtgcggtggcagtggatggtctgggcccacagcc
tgcgttacaggagccacatgcacttcctacaacagctactactcccagtgcattccaacc
gcctcctag

DBGET integrated database retrieval system