KEGG   Aspergillus fumigatus: AFUA_3G03870Help
Entry
AFUA_3G03870      CDS       T01017                                 

Definition
(RefSeq) endo-1,4-beta-glucanase
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_61 CBM_1 CSD Sporozoite_P67
Motif
Other DBs
NCBI-GeneID: 3506054
NCBI-ProteinID: XP_748707
UniProt: Q4WF08
Position
3
AA seq 342 aa AA seqDB search
MRHVQSTQLLAALLLTTRVTAHGHVTNIVINGVSYRGWNIDSDPYNPDPPVVVAWQTPNT
ANGFISPDAYGTNDIICHLNATNARGHAVVAAGDKISIQWTAWPDSHHGPVIDYLARCGS
SCETVDKTTLEFFKIDGVGLVDGSNPPGVWGDDQLIADNNSWLVEIPPTIAPGYYVLRHE
LIALHGAGSQNGAQNYPQCFNLQITGSGTAQPSGVKGTELYSPTDPGILVNIYNALSTYI
VPGPTLIPGAVSVVQSSSTITASGTPVTGSGSAPTTSATTTLSTTTRATTTTTTTTAGSS
TSVQSVYGQCGGSGWSGPTACVTGATCTSYNSYYSQCIPTAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgttcaatctacgcagctgcttgcagcgcttctcctcactacccgcgtcaca
gctcatggtcatgttacaaacatcgtaatcaacggggtttcgtaccgcggatggaatatt
gattcggatccctacaatcctgatccgccggtggtggtagcgtggcagacccccaacacg
gcgaatggcttcatctccccagatgcgtatggaacgaacgatatcatctgtcatctcaac
gccaccaacgcgcgagggcatgctgtggttgcggcgggcgacaaaatatccattcaatgg
accgcttggccagattcccaccatggaccagtcatcgactacctggcgaggtgcggttcg
agctgcgagacggtagacaagacgactctggagttcttcaagatcgatggtgttgggctg
gtggacggctcaaacccaccgggggtctggggtgacgatcagttgatcgcggataacaac
tcgtggctggtggagatccctccgaccattgccccgggctattatgttcttcgacatgag
ttgattgcgttgcatggagccggcagccagaatggagcccagaactacccccaatgtttt
aaccttcagattacagggtcggggaccgcgcagccctcgggtgtgaagggcacagagctc
tattcacccacagatccgggcattctggtcaatatctataacgcgctttcgacgtatata
gtgccgggtcccacgctcattcccggggctgtgtcagttgtgcagtccagttcgaccatc
actgcgtcgggaacgccggtaactggcagtggtagtgctccgactaccagtgccactaca
acgctgtccacgacaaccagggccaccacgaccacaactacgaccacggcgggcagctcg
acttcagttcaatcggtctacgggcagtgcggtggcagtggatggtctgggcccacagcc
tgcgttacaggagccacatgcacttcctacaacagctactactcccagtgcattccaacc
gcctcctag

DBGET integrated database retrieval system