KEGG   Aspergillus fumigatus: AFUA_3G03970Help
Entry
AFUA_3G03970      CDS       T01017                                 

Definition
cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afm  Aspergillus fumigatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afm00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 479 aa AA seqDB search
MTVSTMADVSGAQKSPAVALPEYTLKEVALHNRKDDNWIVIHGQVYDVTKYQKDHPGGAD
VLAEVAGSDATEAFEDIGHSEDSREILEEFLIGTLQGAKEYVAPKKVRIIAQSPVETPAS
SSATRYVGAVTSLLGAVASLIYVYRRGSLYALDTTGSLHRYLSQPLRGVRLPQGGFANGF
LAATLICAAAGGVIARKAAKLTKIESGFLQYPPHIKARKVPRADPHLLKGFLDSKEFQRL
PLIQKDQLSSNVYRFVFGLPDSNGVIGLPIGQHVAIRAVIDGVTVSRSYTPVSNNLDRGR
LELVVKCYPDGVLSGKYLANLQVGDEVEFRGPKGAMRYKPGFCKKMGMVAGGTGITPMYQ
LIRAICEDERDTTEISLIYANRTEADILLRDELEQFARKYPKNFKLWYMLDTAPENWAYG
SGFVNQEVLSERLFAPSPDTKVLLCGPPGMVSATKKMLAAIGFQKPGPVSKMTDQIFCF
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcaaccatggcagatgtcagcggtgctcagaaaagccctgctgttgcttta
cccgagtacacgctgaaggaagttgcgctgcataaccgcaaagacgacaattggattgtg
atccacggacaagtgtacgatgtgacaaaataccagaaagaccatcctggcggcgcagat
gttctggcggaagttgccggctcagatgcgacagaagcatttgaagacatcggccattca
gaagattcgcgcgaaattctcgaggaattcctgatcggaacccttcagggcgcgaaagaa
tatgtcgctccgaagaaagttcgcatcattgctcagagccccgtcgagactcctgcttct
tcatcagcaacccgatacgtaggagcggtcaccagtctgctgggagcagtcgcctccttg
atctatgtctaccgtcgcggttccctgtacgcacttgacaccacggggtcactccacaga
tatctgtctcagcccttaaggggggtaaggttgccgcaggggggcttcgccaatggattt
ctcgcagctactctgatttgtgcggcagcaggtggtgtgatcgcacgtaaagccgccaaa
ctaaccaagatcgagtcgggattcctgcagtatccaccgcatatcaaggcacgtaaggtg
cccagggctgacccgcacttgcttaaagggttccttgattcaaaggagtttcagcgcctg
ccgctcatccagaaggatcagttatcttcaaacgtataccgcttcgtgttcgggttaccg
gatagcaatggagtgattggtctacccatcggtcagcacgtcgccattcgcgctgttatc
gatggtgtcaccgtgagccggtcgtatacacccgtttccaacaacctagaccgaggaagg
ctggaattagtcgtgaaatgctatccggatggcgtgctctctggaaaatacctagcgaac
ctgcaagtgggtgacgaggtcgaattcagaggacccaaaggcgcgatgcgctacaaacca
gggttctgcaagaagatgggaatggtagccggcggaacaggaatcacacctatgtaccag
ctgatccgtgctatctgcgaagatgagcgtgatacgacggagatcagccttatctacgcc
aacagaactgaggcagacatcttactgcgggatgaactcgagcagtttgcccgcaaatac
cccaagaatttcaagctgtggtacatgcttgacacggccccggagaattgggcgtatgga
agcggcttcgtcaaccaggaggtcctcagcgagcgactattcgcgccttcgcctgacact
aaggtcctcctctgcgggcctccgggcatggtgagcgctaccaagaagatgctggctgcg
attggattccagaagccagggccagtttcgaagatgaccgaccagattttctgcttctaa

DBGET integrated database retrieval system