KEGG   Aspergillus fumigatus: AFUA_3G05350Help
Entry
AFUA_3G05350      CDS       T01017                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
afm  Aspergillus fumigatus
Brite
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFUA_3G05350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 140 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAATGDKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagctgccgagaagaagcctagcactggtggcaaggcacccgctggaaag
gctcctgctgagaagaaggaagctggcaagaagacagccgctgctgccactggcgacaag
aagaagcgtggcaagaccaggaaggagacctattcctcctacatctataaggttctcaaa
caggttcatccagacactggtatctcgactcgtgccatgtctatcctgaactcctttgtc
aatgatatctttgagcgcgtcgccacggaggcgtcgaagcttgctgcttacaacaagaaa
tcgaccatctcgtcgagggagatccagacttctgttcggctcatcctccctggtgagttg
gcgaagcacgccgtttcggaaggcacaaaggcggtcacgaagtactcttcttctgccaaa
tag

DBGET integrated database retrieval system