KEGG   Aspergillus fumigatus: AFUA_3G05370Help
Entry
AFUA_3G05370      CDS       T01017                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afm  Aspergillus fumigatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_3G05370
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFUA_3G05370
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_3G05370
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AFUA_3G05370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 445 aa AA seqDB search
MLRSWGKEVRAHYAALADRRHSIEPIYPGAVSPASAAIRSEITVSQFALDSMTLFADLAA
ADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKIDVSVNAPESGTIKELL
VNEEDTVTVGQDLVKLELGGAPGPKEETATEKPKEPADVGKRPPVESNKPQPSEAPKASS
PPPEQPPTAKPQPPAPKSDSPSDVKPSFEGREERRVKMNRMRLRIAERLKQSQNTAASLT
TFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNASIEGPNGGD
TIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIADLGKKARDNKLTIEDMAGG
TFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPTVVNGKVEIRPMMYLALTYDHRLL
DGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgctccgttcttggggtaaggaggttcgcgcacattatgctgctctggctgaccgtcga
cattccatagagccaatttaccccggggcagtctcgcccgcctcggcggctatcagatca
gaaattacggtatcgcaatttgctttagattcaatgacgttgttcgctgatctcgccgca
gctgataccatagtgaaggtccctcagatggcggaatcgatcaccgagggtacattgaag
caattctcgaagcaggtgggcgattacgttgagcgggacgaagaaatcgctacaattgag
accgacaagatcgacgtctcggtcaatgcgcccgagtctgggactataaaggagctcctc
gtgaacgaagaagacactgtgacggttggccaggacttggtcaaactcgaattaggtggt
gctcctgggccaaaagaggagacagctactgagaagccaaaggagcccgcagatgtcggg
aagcggcctcctgttgaatccaacaagccacaaccgtcagaggcccccaaagcttcatcg
cctccgcctgaacagcctcctactgccaagcctcagccccctgctcctaagtcagactct
ccttctgacgttaaacctagctttgaaggtcgtgaggaacgcagggtgaaaatgaataga
atgagactgagaatagccgagcgcctgaagcagtcccaaaacaccgcagcctcgctcact
accttcaacgaagttgacatgtcatccctcatggaatttcgaaaactctacaaagatgat
gtgctgaagaaaaccggtgtcaagcttggcttcatgagcgctttctctcgtgcctgtgtc
ctagctatgaaggacgtccccgccgttaatgcatcaatcgaaggccccaatggtggtgat
accattgtttaccgcgactacgttgacatcagcgtggccgttgctactgagaagggtctt
gtgacacctgtcgtccgtaacgctgaaacaatggacctcgtcggaattgaaaaggccata
gcagaccttggcaagaaggcacgggacaacaagttgacaatcgaggatatggctggtggc
acgttcaccattagcaacggtggtgttttcggctctttgatgggcactccgatcatcaac
ttgccccagactgctgttcttggactccatgcaatcaaggaccggccaacagtcgtgaac
gggaaagtggaaattcgtccaatgatgtaccttgccctaacctatgatcaccgacttttg
gatggacgggaggcagtcactttccttgtcaaggtcaaggaatacattgaagatcctcgt
cggatgttgcttggctag

DBGET integrated database retrieval system