KEGG   Aspergillus fumigatus: AFUA_3G05390Help
Entry
AFUA_3G05390      CDS       T01017                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AFUA_3G05390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_32 Methyltransf_23 MetW Methyltransf_11 Methyltransf_12 PrmA FtsJ Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 3512663
NCBI-ProteinID: XP_755062
UniProt: Q4WWC9
Position
3
AA seq 243 aa AA seqDB search
MAWYCSGTTNAELIENLSKEGLIKNDRVKKAMMGVDRAHYAPSRPYSDSPQPIGHGATIS
APHMHGHACEYLVEFIKPGSRVLDIGSGSGYLTHVFANLVTDRSTNDASGQVIGVDHIPE
LVDLALANMSKSEQGRTLLNSGKVKFITADGRLGWREGAPYDAIHVGAAADKLHPVLIEQ
LRAPGRLFIPVDVENDDGPLSSLGLGGGQYIWVVDKKEDGSVHKEKIFQVSYVPLTDAPK
RSA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtactgttccggcactacaaatgctgagttgattgagaacctctccaaggaa
ggactgataaaaaatgatcgggtgaaaaaagctatgatgggtgtcgatcgcgcccattac
gcgccctcgaggccatactccgactcaccgcaacctatcggacatggagcgacgatttcg
gcgccacacatgcatggccatgcttgcgaatacttagttgagttcatcaagcccggatcc
cgggtactggatatcggctcaggatccggttatttgacgcatgtcttcgcaaatcttgtt
acagataggtctaccaatgatgccagtggtcaggttatcggagtggaccatatcccagaa
cttgttgacctagccctggcgaacatgagcaagtcagagcaaggtcgcactctcctaaat
tccggaaaagtgaaattcatcaccgccgatggtcggcttggctggagggaaggggcacct
tacgatgcaatccatgtgggcgcagcggcagataagttacacccggttctcattgagcag
ctacgtgccccaggacgcttgttcatacccgttgatgtggaaaatgacgacggaccccta
agtagccttggacttggtggtggacagtacatatgggttgttgacaagaaagaggatggc
tctgttcacaaggagaaaattttccaggttagctatgtgccattgacggatgcgccgaag
cgatcagcctaa

DBGET integrated database retrieval system