KEGG   Aspergillus fumigatus: AFUA_3G05900Help
Entry
AFUA_3G05900      CDS       T01017                                 

Definition
MAP kinase kinase Ste7 (EC:2.7.1.-)
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
afm  Aspergillus fumigatus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_3G05900
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AFUA_3G05900
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AFUA_3G05900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 536 aa AA seqDB search
MADQFKARTLKRKNVKGLALNSTPKPLPKPSEGDAQIPGAIGNTDSNRTDTLEIGLEFRL
DLRSEDLITLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDC
NSPHIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRVDVLGKITESVLAGLVYL
YEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAY
TVRSDVWSVGLTVMELAVGRFPFDTSDSSAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILHEFVAKCLLKKPEERPTPRELYDKDAFLQAAKRTPVDLQEWAISMMERHNRKSY
LAPPAPKSLKEEAGHPTPPPKPAVSRPSRTPGHVPTSGEIPLNIANDSSSSSHSRHYNVP
SDSSGHMARTTRSPPPLSLEHLSLETREEEYRTGRRPSRNYLGDPVSAIDAPSRPQISSR
SASSHNTKSRMPLQTATLPLRAAPPPSGPPPPAPVSAGGSWRHQMNQSRGDMTGAV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccagttcaaagctcggacgctgaaacggaagaatgtcaagggccttgccctg
aactctactccaaaacctcttcccaaaccctcggaaggtgatgctcagattcccggtgcc
attggaaacaccgacagcaaccgcacagatactctggagattgggttggaattccgactg
gatcttcgaagtgaggatttgatcactctgaaagagctaggggctggaaatggaggaact
gtatccaaggtgatgcacgcatccaccaaggtggtgatggccagaaagatcattcgcgtg
gatgccaaggagaatgtgagaaagcagatcttgcgtgaactgcaagttggccatgactgc
aactcccctcacatcgtgaccttttacggagcattccagaatgaagcgagggacattgtt
ctatgtatggaatacatggactgcggatccctcgaccgcatttccaaagactttggacct
gttcgagtagatgtgctcggcaagatcacggagtcggttcttgccggcctggtgtacctc
tatgaagctcaccgcataatgcatcgtgacatcaagccgtccaacatcctcgttaactcc
cgtggtaatatcaaactttgcgactttggtgtcgcgaccgagacggtcaactcgatcgcc
gacactttcgttgggacctcgacctacatggcaccggagcgaatccaaggcggcgcttac
acggtgcgctcagacgtatggagtgtgggattgactgtcatggaattggcggtcggacgc
tttccctttgatacttcggactcgtctgcaggcgatcgcgccagtgctggaccaatggga
attctagatctcttgcaacagattgttcacgagcctgcacccaagctgccgaagagcgat
gctttcccgcctatcttgcatgaatttgtcgccaagtgtctcctcaagaaacctgaagaa
cgaccaactcctcgggagctctatgataaggatgctttcttgcaggctgccaaacgtact
ccggttgatcttcaagaatgggctatcagcatgatggaaaggcacaaccgcaagtcgtat
ttggctcccccggctcccaaatcactcaaggaagaggcaggccatcccacgcctcctcca
aagcccgccgttagccggccatctcggacccccggccacgtgcccacgtctggagagatt
cccttgaacatcgccaatgactcctcaagctcctcccattcccgtcactacaacgtcccc
tcagactcgtccgggcatatggctagaacgacccggtcgcctcctcccttatcgctggag
cacctgtcgctggaaaccagagaggaagagtatcgaactggtcgtcgtccatcgcgcaat
tatctgggagatcccgtgtcggccattgacgcgcctagtcgaccccaaatcagttctcgg
tcggccagctcccacaacaccaagtcgagaatgccacttcagacggcaactttacccctc
cgtgccgcccctcccccgagcgggccacctccgccggctcccgtgtctgctggaggttcc
tggcggcaccagatgaaccagtcgcgcggcgatatgacgggagctgtctaa

DBGET integrated database retrieval system