KEGG   Aspergillus fumigatus: AFUA_3G08100Help
Entry
AFUA_3G08100      CDS       T01017                                 

Definition
checkpoint protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
afm  Aspergillus fumigatus
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:afm04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 841 aa AA seqDB search
MASPNSLSSAYTSGLRRQPSLRQMSRSTLSRSNSRHTSPALDYHTTSRNEGVSISRQYSA
GDSSDDEVPEPKFSASVKALLDEDGLGSSPHLKYSSNERPSSTERAMSAATSQSRQSRTS
SPLDRSTGSPAPRVVRIAPALANNNRHAREGSPLAQSESAGSSANYSSKELITPAPRPRS
VRITGSRSHTRSPTSESPSQKRSADRSSVHEHSSAERSENGRTVNYEDDYAPRFSTASVL
RSRHGDDVGMQSSLRVKRVGRLTGTFLNGPARRGVLRRQSEENHDPQSYSAERHRESSLD
PNDDNAEYRYNAKTRTSSSPKVTWADPSPSQEAERPRAYDPASASSGEGPFSRSSSPRSS
GSHSKSTPGSASEMSSKPSSAHEEPVFKVPPLPQLPATRDQENEPPPTFKRDKPHGLSLL
SKPEKLSVVYGDDKKDNEETPAGHSPRKILATRSSNTPHRPAPPPPKMSMLETATATGGA
ATASQSRKKRSQVSVNHKPFTRLDCIGRGGSSRVYRVMAENYKIFALKRVNLEDVDPVTL
AGYKGEIDLLKRLENIDRVVRLFDWELNSDKHTLSVLMEIGESDLEKILTYRLNAEDAVF
DINFTRYYWKEMLECVQAVHNCNIVHSDLKPANFLLVQGRLKLIDFGIANAIQDNTVNVH
REQQVGTPNYMSPEALIDSNASLGLPASVGKMMKLGKPSDVWSLGCILYKMVYGQPPFAK
IAKYYERIMAIPNPKVQIDFPAFGVGGVAIPPGLIRTLKRCLQRDQTLRPTVEELLSQRD
SFLYPDAQLEGTVPVNQDMLGRILMNVVHHCRTRGIPKDEEIAAWPAGFYAKIKAALEEN
T
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccgaattctctttcctccgcatatacgagtggtctgcgccgacaaccatca
ctgcggcaaatgtctcgttctacgctttctcgctcgaattctagacacacttcaccagct
ctcgactatcatacaacgtcgcggaatgagggagtttcgatttcgagacagtattcagcc
ggtgacagctccgatgatgaggttccggagcccaagttcagcgcttccgtcaaggctctc
ctcgacgaggacggacttgggtcttcccctcatctcaagtacagcagcaacgagcgtccc
tcttcaactgaacgcgcaatgtcagctgcgacaagtcaatcgaggcagtcccgaacatcg
tcaccccttgatcgatcaaccggaagccccgctcctcgggtagtacgcatagctccagct
ctcgccaacaacaataggcatgcacgagaaggctcccctctagcacagagtgagagcgca
ggctctagcgcgaactatagctcaaaagaactcatcacgccggcccccagaccgcgcagt
gttcgcatcactgggtcgcggagtcatacacggtctcctacttcagagtccccctcccaa
aagcggtcggctgataggagctccgttcatgaacattcgagtgcagagcgttcggaaaat
gggaggacggtgaattacgaggacgactatgcccctcggtttagcactgcatctgttctc
cgctcgcgccatggggatgatgtgggcatgcagagttcccttcgcgtgaaaagagtcgga
aggctcacaggaacatttctaaatggacctgcgaggaggggtgttctgcggcggcagagc
gaggagaaccatgaccctcaaagctattccgccgagcgacatagagaatcgagtctcgac
cccaacgacgacaacgccgaatatcgctataatgctaaaacacgaacctcctcatcgccc
aaggtaacatgggcagaccccagcccgtctcaggaagctgagcgaccccgagcatatgat
cccgctagtgcttcctctggggagggcccattctccaggtcttcatcgccgaggtcctcc
ggatcacactccaaatcgacacctggttccgcctcggaaatgtcctcgaagccttcaagt
gctcatgaggagcctgtcttcaaggtcccaccgcttcctcaactcccggccacccgagac
caagagaatgagcctccaccaacgttcaaacgggataagccccacgggcttagtctccta
agtaaaccggagaagctctctgtggtgtacggggacgacaagaaagacaatgaagagacg
ccagctggacattcccctcgcaagattctagcaacacggagtagcaatacccctcaccgg
ccagcgccccctcctccgaagatgtcgatgcttgagaccgccacggcgacgggaggagcg
gccacggcatctcaatctcgcaaaaagcgaagccaagtctcggtcaatcataagccattc
acgcggctggattgcatcggacgtgggggaagctctcgtgtctaccgcgtcatggccgag
aattataaaatctttgctctgaaacgagtgaatctcgaagatgtcgacccagtgactcta
gctggctacaagggcgagatcgacctcttgaagaggctggaaaacattgatcgggttgtc
cgattatttgactgggaactcaattcggacaagcacaccctcagcgttctgatggaaatc
ggagagtctgatttggagaagattttgacctaccggttgaatgccgaggatgctgtgttt
gatatcaacttcacgcggtattactggaaagagatgcttgagtgtgttcaggcggtccac
aattgcaatattgtgcattctgatctgaagcccgccaacttcctcctcgttcagggaagg
ttgaagctgatcgattttggaatcgccaacgctatccaggataacacggtcaacgtgcat
cgcgagcagcaagtcggcacacccaattatatgtcaccagaagccttgatcgactcgaat
gcctcacttgggcttccagccagtgttggaaagatgatgaagctcggcaagcccagcgat
gtctggagtctaggctgtatcctctataaaatggtctatggccaaccgccatttgccaaa
atcgccaaatattatgagcgcatcatggccatccccaaccctaaagtgcagatcgacttc
ccagcttttggtgttggaggagttgcgataccgccggggctgattcgtaccctgaagcgc
tgcctgcagcgggatcagaccctacgaccgacagtggaagaacttcttagccaaagagat
tcatttttgtaccctgacgcacaattggaaggcactgttcccgtcaatcaggacatgctg
ggcaggatcctgatgaatgttgtccaccactgccggactcggggcatacccaaggacgaa
gaaatagccgcctggccggctggattctatgcgaaaatcaaggcggcactagaagaaaat
acttga

DBGET integrated database retrieval system