KEGG   Aspergillus fumigatus: AFUA_3G08730Help
Entry
AFUA_3G08730      CDS       T01017                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
afm  Aspergillus fumigatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:afm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AFUA_3G08730
Enzymes [BR:afm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AFUA_3G08730
Peptidases [BR:afm01002]
 Metallo Peptidases
  Family M67
   AFUA_3G08730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 532 aa AA seqDB search
MGASPPQSVEKITRIAQDYEYNPLIPLRNWLRTASTLLREARIYEREGHDEQTYLLLFRH
AQLVLVNLANHPDAKDEKYRKALMEAEKDVRINLGKLEALKPRINKRYEHYVQLMRERQA
RTSHQETTSSKQVQPYDPALAGVVEPLEAGKNRDLAVQLARTEISRRATVRKALRQAGVP
QEEEQSRRTAGVWNNWEIATDKDGPGMDNDLSRRIQNVRLNIDQQTHANARPQQLKPAEP
STSTYSYPSVPRTKPLEPLPSASTNVSRDGNSLRLEAPLPPPKERFGSSHPSFTDGATPP
LLPDKVSSTPAPAVPEKGQPLAAGGNSRPDLNPSSFTFKPSAYLENGTPLRTVWLPPDLR
THFLAIAGPNTRRNLETCGILCGTLISNALFVSRLLIPEQTATSDTCETVNESAIFDYCD
SEDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPSKSPDWGVFRLTDPP
GLKTVLNCTQSGLFHPHAEANIYTDALRPGHVYEAKGLEFETVDLRPKGSRG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgtcaccacctcagagcgtggagaagatcacacggattgcgcaagactacgag
tacaacccccttataccgctacgaaactggttgaggaccgcgtccacgctcctcagagag
gctcgaatatacgaacgggaaggccatgacgagcaaacatacctactgttatttcgacat
gcgcaactagtactcgtgaacctagcaaaccaccccgatgctaaagatgaaaagtacaga
aaggctctcatggaggccgagaaggacgtacggatcaatctagggaaattagaggcgctg
aaaccccggatcaataaacgatatgagcattacgtccagttgatgcgcgaacgtcaagct
cggacttcgcatcaggaaacaacctcgtcgaagcaggtgcaaccatatgaccccgcgttg
gcgggagtagtcgaacctttggaggcagggaagaacagagatttggcagtgcagcttgca
cggacagagatcagccggagggcaaccgtcaggaaagccttgcgtcaggctggtgtgcca
caagaagaggagcaaagccggcgtacggcgggtgtctggaacaactgggaaattgcaacg
gataaagatggacctgggatggacaatgacctgagccgccggattcaaaatgtgagactc
aacatcgaccagcaaactcatgcgaacgctcgtccgcagcaattgaagcctgcagagcca
tcaactagcacctacagttatccctccgtcccccggacaaaaccgctggagcctttgcca
tctgcgtcgacgaacgtgtcccgagatggaaacagcttgcgcttggaagctccattgcca
ccgccaaaggagcgattcggatcaagtcatccgtcatttactgacggagcgaccccgcca
ctactgcccgacaaggtctcgtcgaccccggccccggctgttccagagaagggacagccg
ttggcagctggcggaaactcacgtccagacctgaacccctccagcttcacattcaagccg
tcggcatatctagagaatgggacaccgctgcgcaccgtgtggctacctcccgatctacga
acgcattttttggccatagcgggccctaacacgcgacgcaacctagagacgtgcggcatc
ctgtgcggaactttgatttcgaacgcactatttgtctctaggctgcttattccagaacaa
acggcgacgtcagacacatgcgaaaccgtaaacgagtctgcgatctttgactactgcgat
tccgaggatttgatggtgttaggctggatccatacgcaccccacacagacttgttttatg
agttcgagggaccttcacacgcattgtggataccaggtgatgctccctgagagcatcgcg
attgtttgtgcgccaagtaaatcccctgattggggtgtgttccgactgactgatcccccg
gggcttaagacggtcctgaactgcacgcagagtgggctatttcatccccatgcggaagct
aatatttacaccgatgcgctgcgacctgggcacgtctatgaagccaaagggttggaattt
gagactgtggatcttcgtccaaagggatcccggggttga

DBGET integrated database retrieval system