KEGG   Aspergillus fumigatus: AFUA_3G08980Help
Entry
AFUA_3G08980      CDS       T01017                                 

Definition
threonine synthase Thr4 (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFUA_3G08980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_3G08980
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AFUA_3G08980
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AFUA_3G08980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 506 aa AA seqDB search
MSSLKDWRPMVACSSPKKSLRFLRDGRQNLAYRIMSLYISPSEIPSEDLQDIIRRSYATF
RHPERTPLVELDGKRNLYLLELFHGPTFAFKDVALQFLGNLFEYFLVRKNEGKEGKDRHH
LTVIGATSGDTGSAAIYGLRGKKDVSIFILFPTGRVSPIQQAQMTTVLDANVHNLTVEGS
FDDCQDIVKALFADPDLNSTHNIAAVNSINWARILAQITYYFYSYFSLTKTSAFSKDTKM
RFVVPSGNFGDILAGWFAKRMGLPAEKLVIATNENDILDRFFRSGGQYTKNTTQAEGVKE
THSPAMDILVSSNFERLLWFLAFQADCAGSVDGRRKHACESVSNWLNQLKTQGGFTVPQA
VLEGAKAEFESERVSNGETIDQIKSTYTSSFPSNLGPGSAKSSKTGGYILDPHSAVGVRA
ALRSIERNPGVKHISLSTAHPAKFASAVDLALRAEDGYDFTEVLPQEFIGLEQRESRVTP
IRAGAGWVGVREVVKAEVEQELQGLR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccttaaaggactggcgtccgatggtggcctgttcatccccgaagaaatccctt
cgcttcctgcgggatgggagacagaatctcgcatatcgtatcatgtcattgtacatctcg
ccgagcgaaatcccctcggaagacctccaagatatcattagacgctcatacgctacgttc
cggcaccctgagaggacgcctctggttgaattggatggaaaacgcaacctctacttgctc
gaattgttccatggaccaacattcgccttcaaggacgtcgcgctacagttcctcggaaac
ctctttgaatatttcttggtgcgcaagaatgaaggcaaggagggtaaggacagacaccac
ctgaccgttattggtgctactagtggcgatactggatcggcagcgatctatggtctccgg
ggcaagaaggatgtctccatcttcatcctcttccccactggacgggtgtcgcctatccag
caagctcagatgacgacagtcttggatgccaacgtccacaacctgacagtcgagggctct
ttcgatgattgccaggacattgtaaaggccttgtttgctgatcctgatctcaactcaacc
cacaacattgctgctgttaactccatcaactgggctcgtatcctggctcagatcacatac
tacttttactcctacttctctcttaccaagacctccgccttctccaaagacacgaagatg
cgcttcgtcgttccttcaggaaatttcggtgacattctcgccggatggttcgctaagcgc
atgggtcttcccgctgagaagcttgtcatcgcaaccaacgagaacgacatcctggaccgc
ttcttccgtagtggtggccagtacaccaagaacaccactcaggccgaaggcgtcaaggag
actcacagccccgccatggacatccttgtcagcagcaactttgagcgtctcctctggttc
cttgcattccaggcggactgcgccggctctgtagacggaagacgcaagcatgcctgtgag
agcgtcagcaattggctcaatcagctcaagacacagggtggtttcaccgtaccccaggca
gtcctcgagggcgccaaggccgagtttgagagcgagcgggtgagcaacggcgagaccatt
gaccagattaagtccacctacacctcttccttcccctccaatctcggccctggcagcgcc
aagagctccaagactggcggttacattctcgaccctcactctgccgtcggtgtgcgggca
gctctgcggtctatcgagcggaatcctggtgtcaagcatatctccctctccacagcccac
ccggccaagttcgccagcgccgtcgacctggcccttcgcgccgaagacgggtatgacttc
accgaggttcttcctcaggaattcatcgggctcgagcagcgcgaaagccgagttactcct
atccgcgccggcgccggatgggtaggtgtccgggaagtagtcaaggccgaagtcgagcag
gagctgcagggcttgaggtag

DBGET integrated database retrieval system