KEGG   Aspergillus fumigatus: AFUA_3G08980Help
Entry
AFUA_3G08980      CDS       T01017                                 

Definition
(RefSeq) threonine synthase Thr4
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00260  Glycine, serine and threonine metabolism
afm00750  Vitamin B6 metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01230  Biosynthesis of amino acids
Module
afm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_3G08980
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AFUA_3G08980
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AFUA_3G08980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 3511986
NCBI-ProteinID: XP_754718
UniProt: Q4WXC3
Position
3
AA seq 506 aa AA seqDB search
MSSLKDWRPMVACSSPKKSLRFLRDGRQNLAYRIMSLYISPSEIPSEDLQDIIRRSYATF
RHPERTPLVELDGKRNLYLLELFHGPTFAFKDVALQFLGNLFEYFLVRKNEGKEGKDRHH
LTVIGATSGDTGSAAIYGLRGKKDVSIFILFPTGRVSPIQQAQMTTVLDANVHNLTVEGS
FDDCQDIVKALFADPDLNSTHNIAAVNSINWARILAQITYYFYSYFSLTKTSAFSKDTKM
RFVVPSGNFGDILAGWFAKRMGLPAEKLVIATNENDILDRFFRSGGQYTKNTTQAEGVKE
THSPAMDILVSSNFERLLWFLAFQADCAGSVDGRRKHACESVSNWLNQLKTQGGFTVPQA
VLEGAKAEFESERVSNGETIDQIKSTYTSSFPSNLGPGSAKSSKTGGYILDPHSAVGVRA
ALRSIERNPGVKHISLSTAHPAKFASAVDLALRAEDGYDFTEVLPQEFIGLEQRESRVTP
IRAGAGWVGVREVVKAEVEQELQGLR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccttaaaggactggcgtccgatggtggcctgttcatccccgaagaaatccctt
cgcttcctgcgggatgggagacagaatctcgcatatcgtatcatgtcattgtacatctcg
ccgagcgaaatcccctcggaagacctccaagatatcattagacgctcatacgctacgttc
cggcaccctgagaggacgcctctggttgaattggatggaaaacgcaacctctacttgctc
gaattgttccatggaccaacattcgccttcaaggacgtcgcgctacagttcctcggaaac
ctctttgaatatttcttggtgcgcaagaatgaaggcaaggagggtaaggacagacaccac
ctgaccgttattggtgctactagtggcgatactggatcggcagcgatctatggtctccgg
ggcaagaaggatgtctccatcttcatcctcttccccactggacgggtgtcgcctatccag
caagctcagatgacgacagtcttggatgccaacgtccacaacctgacagtcgagggctct
ttcgatgattgccaggacattgtaaaggccttgtttgctgatcctgatctcaactcaacc
cacaacattgctgctgttaactccatcaactgggctcgtatcctggctcagatcacatac
tacttttactcctacttctctcttaccaagacctccgccttctccaaagacacgaagatg
cgcttcgtcgttccttcaggaaatttcggtgacattctcgccggatggttcgctaagcgc
atgggtcttcccgctgagaagcttgtcatcgcaaccaacgagaacgacatcctggaccgc
ttcttccgtagtggtggccagtacaccaagaacaccactcaggccgaaggcgtcaaggag
actcacagccccgccatggacatccttgtcagcagcaactttgagcgtctcctctggttc
cttgcattccaggcggactgcgccggctctgtagacggaagacgcaagcatgcctgtgag
agcgtcagcaattggctcaatcagctcaagacacagggtggtttcaccgtaccccaggca
gtcctcgagggcgccaaggccgagtttgagagcgagcgggtgagcaacggcgagaccatt
gaccagattaagtccacctacacctcttccttcccctccaatctcggccctggcagcgcc
aagagctccaagactggcggttacattctcgaccctcactctgccgtcggtgtgcgggca
gctctgcggtctatcgagcggaatcctggtgtcaagcatatctccctctccacagcccac
ccggccaagttcgccagcgccgtcgacctggcccttcgcgccgaagacgggtatgacttc
accgaggttcttcctcaggaattcatcgggctcgagcagcgcgaaagccgagttactcct
atccgcgccggcgccggatgggtaggtgtccgggaagtagtcaaggccgaagtcgagcag
gagctgcagggcttgaggtag

DBGET integrated database retrieval system