KEGG   Aspergillus fumigatus: AFUA_3G09220Help
Entry
AFUA_3G09220      CDS       T01017                                 

Definition
P450 family fatty acid hydroxylase (EC:1.14.14.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFUA_3G09220
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFUA_3G09220
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AFUA_3G09220
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFUA_3G09220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1120 aa AA seqDB search
MSESKTVPIPGPRGVPLLGNIYDIEQEVPLRSINLMADQYGPIYRLTTFGWSRVFVSTHE
LVDEVCDEERFTKVVTAGLNQIRNGVHDGLFTANFPGEENWAIAHRVLVPAFGPLSIRGM
FDEMYDIATQLVMKWARHGPTVPIMVTDDFTRLTLDTIALCAMGTRFNSFYHEEMHPFVE
AMVGLLQGSGDRARRPALLNNLPTSENSKYWDDIAFLRNLAQELVEARRKNPEDKKDLLN
ALILGRDPKTGKGLTDESIIDNMITFLIAGHETTSGLLSFLFYYLLKTPNAYKKAQEEVD
SVVGRRKITVEDMSRLPYLNAVMRETLRLRSTAPLIAVHAHPEKNKEDPVTLGGGKYVLN
KDEPIVIILDKLHRDPQVYGPDAEEFKPERMLDENFEKLPKNAWKPFGNGMRACIGRPFA
WQEALLVVAILLQNFNFQMDDPSYNLHIKQTLTIKPKDFHMRATLRHGLDATKLGIALSG
SADRAPPESSGAASRVRKQATPPAGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFAAD
VQSLDSAMQNVPKDEPVVFITASYEGQPPDNAAHFFEWLSALKENELEGVNYAVFGCGHH
DWQATFHRIPKAVNQLVAEHGGNRLCDLGLADAANSDMFTDFDSWGESTFWPAITSKFGG
GKSDEPKPSSSLQVEVSTGMRASTLGLQLQEGLVIDNQLLSAPDVPAKRMIRFKLPSDMS
YRCGDYLAVLPVNPTSVVRRAIRRFDLPWDAMLTIRKPSQAPKGSTSIPLDTPISAFELL
STYVELSQPASKRDLTALADAAITDADAQAELRYLASSPTRFTEEIVKKRMSPLDLLIRY
PSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECSITFSVLNAPALAAASLPPAERAEA
EQYMGVASTYLSELKPGERAHIAVRPSHSGFKPPMDLKAPMIMACAGSGLAPFRGFIMDR
AEKIRGRRSSVGADGQLPEVEQPAKAILYVGCRTKGKDDIHATELAEWAQLGAVDVRWAY
SRPEDGSKGRHVQDLMLEDREELVSLFDQGARIYVCGSTGVGNGVRQACKDIYLERRRQL
RQAARERGEEVPAEEDEDAAAEQFLDNLRTKERYATDVFT
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgaaaacggtccccattccagggccgagaggagtgcctctgctgggaaac
atttatgatatcgagcaagaggtgcctctgagaagtatcaatctgatggccgatcaatat
ggccccatctaccgactgacaacgtttggctggtccagagtattcgtcagcacgcacgaa
ctcgtcgatgaggtctgtgacgaagagcgattcaccaaggtcgtcacggcggggttgaat
cagattcgaaacggcgttcacgatgggttgttcacggccaatttccccggggaggaaaac
tgggcgattgcccatcgtgtgctcgtgccggcctttggacctctgtccattcgaggcatg
tttgacgaaatgtacgatatcgcgacgcaactcgtcatgaaatgggcgcgacatggaccg
accgttccaatcatggtaaccgacgatttcacccggttgaccttggacaccattgccctt
tgcgcgatgggaacccgtttcaattctttctaccacgaagagatgcatccttttgtcgag
gcaatggtgggcctgttgcagggatccggtgaccgggctcgtcgacccgcgctgctcaac
aatctgcccacgagtgagaattccaagtattgggacgacattgcctttctacggaaccta
gcacaggaattggtcgaagcgcggaggaagaatcccgaggataagaaggatcttttgaat
gcgctgatcttggggcgtgaccccaagactggcaagggcttgaccgatgagtcgatcatt
gacaacatgattacattcctgattgctggccacgaaacgacctccggcctgctctccttc
ctattctactacctgctgaaaacccccaatgcatacaagaaagcgcaagaagaggttgac
tctgttgttggacggcggaagatcactgtggaggatatgtccaggttgccgtatctcaat
gctgtgatgcgggagacgctgcgtctgaggtctacagcccctctgattgctgtacatgcc
caccccgagaaaaacaaggaggaccccgttaccctgggaggtggtaaatatgttttgaac
aaggatgagcccattgtgatcatcctggacaaactgcaccgcgacccccaggtctatggg
cccgatgcagaagagttcaagccggagcgaatgctggacgagaactttgagaagcttccc
aagaatgcctggaagccgttcggcaacgggatgcgtgcctgcatcggccgccctttcgcc
tggcaggaagctttgctggtagtggctatcctgctgcagaattttaattttcagatggac
gatcccagctacaatcttcatataaagcagacgctcaccatcaaaccgaaggactttcat
atgagagcaactctgaggcatggactggatgctaccaaactcggcatcgccctgagcggc
agcgcggaccgtgcgccgcctgagagctcgggagccgcgagcagggttcgcaagcaagcc
actcctccggcgggtcagctcaagccgatgcacatcttctttggaagcaacacaggaacg
tgtgagacgtttgcacgtagattggccgacgatgccgtggggtatggatttgctgccgac
gtccaatctctggattccgccatgcagaatgttccgaaagacgaaccagtggtgttcatt
acggcatcatacgaaggtcaaccgcccgacaacgctgctcactttttcgaatggctcagc
gccttgaaggaaaatgagctcgagggtgttaattatgccgtgtttggctgtggtcatcac
gattggcaggctaccttccatcgcatccccaaagcagtcaatcagctcgtcgcggagcat
ggaggaaatcggttgtgtgatcttggactagccgatgccgccaactcggacatgttcacc
gactttgactcgtggggcgagtccaccttctggcctgcaatcacatccaagtttggaggt
ggaaagtcggacgagccgaagccgtcgtccagtctccaagtagaagtcagcacgggaatg
cgcgcctcgacccttggtcttcagctccaggaggggctcgtgatcgacaaccagttgctt
tcagcacccgacgtcccggctaagagaatgattcgattcaagctgccttcggatatgagc
taccgatgcggggattacttggctgtgttgcctgtaaacccgaccagcgtcgttcgccgg
gccattcggcgtttcgatcttccctgggatgccatgctcacaatccgcaaaccgagccag
gcccccaaaggctccacctcgattccccttgacacgcccatctcggcttttgaactcctc
tccacctatgtggaactctcgcagccggcctctaaacgcgacctgaccgcactggcagac
gccgccatcaccgacgccgacgcgcaagctgagctacgctatctggcatccagccccacc
cgattcaccgaggaaatcgtcaagaaacggatgagtccgttggatttgctgatccggtac
ccttcaatcaagctgcctgttggcgatttcctggccatgctcccacccatgcgggtgcgt
caatactccatctcttcttctcccctggcggatccctcagaatgctcgattacgttttct
gtgctcaatgcgccggctctggcggcggcatcgttgccaccggccgagcgagcggaagct
gagcagtacatgggagtcgcctccacctatttgtccgagctgaagccgggcgagcgtgcc
cacatcgccgtgcggccgtctcattccggcttcaagccgccgatggatctgaaggcgcca
atgattatggcgtgcgcgggaagcggacttgcgcccttccgcgggtttatcatggaccgc
gccgagaagatccggggcagacgcagctcggtcggagctgatggccagcttcccgaggtt
gaacagcccgccaaagctatcctgtacgtgggctgccggaccaagggcaaggatgacatc
cacgccactgagcttgccgagtgggctcaacttggcgctgtggacgtgaggtgggcgtac
agccggcccgaggacgggtccaagggccgtcatgtgcaggatctgatgctggaggaccgt
gaagaattggtcagtctgtttgaccagggcgctcggatctatgtgtgtggcagcacgggc
gtagggaacggggtgcgccaggcctgcaaggacatttacctggagcgaagacgccaattg
cgacaggcggcgcgggagcgtggcgaggaagtccctgcagaggaggacgaggatgctgcg
gcggagcagttcctggataatctgaggacaaaggagcgatatgcaacggatgtatttact
tag

DBGET integrated database retrieval system