KEGG   Aspergillus fumigatus: AFUA_3G09230Help
Entry
AFUA_3G09230      CDS       T01017                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AFUA_3G09230
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     AFUA_3G09230
    3.1.1.84  cocaine esterase
     AFUA_3G09230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 551 aa AA seqDB search
MPPFAFKGLALIALGTAVAQAQLWNQIIQTNYGPVQGFKYFNESTLERFFGVSESNVTAF
LGIPFAADTGYQNRWKPPQPREPWNETLKATRFGPRCPTGESSYISEDCLSLNLWTNAGS
ADAKLPVMVWNQGSDETSDQSWWYGGGMALKDVILITFNRRDDVFGYLAHPDLNAEGLAV
TGHNTSGNYGVLDQLEVLKWVKKNIADFGGDPDRVVVAGQSFGSSQVYHAVNSPLFKGYF
HGGISQSGIRYPYDPLLAGLATSYVNMSTALIHGADYMAAHNASSIAELRTLSMEELLVG
SQDRVNSTWISWVTALSAGYPLIFKPVLDNYVLPSKYIETLLNGPANDVPVITGNTKDES
GASPSTNYTVEEYENYTSHKYGDLYNRYIKLYPDNGNQSTADQSWNAAARDASLVGSWAY
ATEWYKAASAPFYTYYWTHAPPGQNQGAFHQSEIMYALNALYANADQYPFTEADYEIQEK
MSAYWANFAKTLDPNKGGSYKGKGVLPHWSPNSPNGTQVVMELGNAFANVPIAKREQVEF
LMEWYHRQIPY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcccccattcgcgttcaagggcctcgccttaatagccctaggtactgcagtcgcccag
gcccagctctggaaccaaatcattcagaccaactatggcccagtccaaggcttcaagtac
ttcaacgagtctacgcttgagagattctttggagtctcggagtccaatgtgacggctttc
ttaggcattccctttgccgcggataccggttatcaaaaccgctggaaaccccctcagcca
cgcgaaccgtggaatgaaactttgaaagccaccaggtttggccctcgttgtcccaccggt
gagtccagctacatcagcgaagattgcctgagtctgaatctatggacgaatgccggctcc
gcggatgctaagctgcctgtcatggtctggaaccagggctcggatgagaccagcgatcag
tcctggtggtatggcggcgggatggccttgaaggatgtcatcctcattaccttcaatcgc
agagatgatgtgttcggatacctggcgcatccggatctgaatgcagagggtctggcagtc
actggtcacaatacatccgggaactatggtgttctcgaccaacttgaggtgctgaaatgg
gtgaagaagaacatcgccgacttcggtggtgaccctgaccgggtggtagtggctggtcag
tcctttggctcttcccaggtgtatcatgctgtgaacagtccactgttcaaaggttacttc
catggtggaatctctcagtccggcatccgatacccatatgacccactgctggctggtctc
gcgacctcttatgtcaacatgtccacggctcttatccacggtgccgactacatggctgcc
cataatgcctctagcatcgccgaattgcggacattgtccatggaggagctgctggtcggc
tcgcaggaccgtgtcaacagcacttggatctcctgggtcactgccctgtccgctggctac
cccctgatcttcaagcctgtcctcgacaactatgtccttccctccaagtacatcgagacg
ctcctcaatggaccagccaacgatgtccccgtcatcacaggcaacacaaaggacgagtcg
ggcgcatccccctccaccaactacaccgtggaggaatacgagaactacacctcgcacaaa
tacggcgacctctacaaccgctacatcaagctgtacccggacaacggcaaccaaagcacc
gctgatcaatcctggaacgccgcggcccgcgacgcctcccttgtcggttcatgggcctac
gccaccgagtggtacaaggccgcatccgccccgttctacacttactactggacccacgcc
ccgcccggccagaaccaaggcgcctttcatcagtcggagatcatgtacgccctgaacgct
ctatacgccaatgccgatcagtatcctttcaccgaagcagactatgagatccaggagaag
atgtccgcctactgggccaactttgcaaagacattggatcctaacaagggaggctcttat
aagggcaagggagtgttaccgcactggagtcctaatagcccgaatggcacccaggtggtt
atggaacttggcaatgcgtttgctaatgtgcccattgccaagagggagcaggttgagttt
ctaatggagtggtaccaccggcagattccatattag

DBGET integrated database retrieval system