KEGG   Aspergillus fumigatus: AFUA_3G11430Help
Entry
AFUA_3G11430      CDS       T01017                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:afm00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 324 aa AA seqDB search
MTAPSTIKQRFLSKPNELGVVAVGFNGGQCKLGVEAAPLALIEAGLLNQVRDDLGYQLHY
DDTVHYYESLTPLSDPDHRGMKKPRAVSVVTETLSKQVYDYAKDGKFVLTLGGDHSIAIG
TISGTAKAIRERLGREMAVIWVDAHADINTPEMSPSGNIHGMPMAFLTRLAREDKKDIFG
WLQDEHIINKNKLVYIGLRDVDRGEKQLLREHGIKAFSMHDIDRHGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLIAMDLVEVNPSLD
EVGASETIRAGCSLVRCALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgccgtcgactatcaagcaaagattcctgtccaagccaaatgagctgggcgtg
gtcgctgtcggatttaacggtggtcagtgcaaactaggcgtcgaagcagccccgctcgcc
ttgattgaagccggtcttttgaatcaagtgcgcgacgacctgggctatcaacttcactat
gacgacactgtgcactactacgagagcctgacccccttgagcgaccccgaccaccggggc
atgaagaagccgcgcgccgtcagcgtcgtgacggagacgctcagcaagcaggtctacgac
tacgccaaggacggcaagttcgtcctcacactaggcggcgaccactcgatcgccatcggc
actatctccggcacggccaaggccatcagggagcgactgggccgggaaatggcggttatc
tgggtcgatgcgcatgccgatatcaacacgccggagatgagccccagcggaaacatccac
ggcatgcccatggccttcttgacccggctggcccgggaggacaagaaggatatcttcggg
tggttgcaggatgagcacatcatcaacaagaacaagctggtgtacatcggcctgcgggat
gtggaccgcggcgagaagcagctgctgcgggagcacggtatcaaggcatttagcatgcat
gacatcgacagacatggaatcggccgcgtggttgaaatggcgctcgctcacatcggcaac
gacacccccatccatctctcgttcgacgttgacgccttggaccctcaatgggctcctagc
acaggcactcccgtccgtggaggtctgactctgcgtgagggtgacttcatctgtgaatgt
gttcacgagactggcaatttgatcgccatggatctggtagaggtcaaccccagcctggac
gaagtcggtgcttcagagaccattcgagccggttgctctttggtgcggtgcgcactgggc
gacacactgctgtga

DBGET integrated database retrieval system