KEGG   Aspergillus fumigatus: AFUA_3G11430Help
Entry
AFUA_3G11430      CDS       T01017                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00220  Arginine biosynthesis
afm00330  Arginine and proline metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01230  Biosynthesis of amino acids
Module
afm_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AFUA_3G11430
   00330 Arginine and proline metabolism
    AFUA_3G11430
Enzymes [BR:afm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AFUA_3G11430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3512537
NCBI-ProteinID: XP_754476
UniProt: Q4WY15
Position
3
AA seq 324 aa AA seqDB search
MTAPSTIKQRFLSKPNELGVVAVGFNGGQCKLGVEAAPLALIEAGLLNQVRDDLGYQLHY
DDTVHYYESLTPLSDPDHRGMKKPRAVSVVTETLSKQVYDYAKDGKFVLTLGGDHSIAIG
TISGTAKAIRERLGREMAVIWVDAHADINTPEMSPSGNIHGMPMAFLTRLAREDKKDIFG
WLQDEHIINKNKLVYIGLRDVDRGEKQLLREHGIKAFSMHDIDRHGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLIAMDLVEVNPSLD
EVGASETIRAGCSLVRCALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgccgtcgactatcaagcaaagattcctgtccaagccaaatgagctgggcgtg
gtcgctgtcggatttaacggtggtcagtgcaaactaggcgtcgaagcagccccgctcgcc
ttgattgaagccggtcttttgaatcaagtgcgcgacgacctgggctatcaacttcactat
gacgacactgtgcactactacgagagcctgacccccttgagcgaccccgaccaccggggc
atgaagaagccgcgcgccgtcagcgtcgtgacggagacgctcagcaagcaggtctacgac
tacgccaaggacggcaagttcgtcctcacactaggcggcgaccactcgatcgccatcggc
actatctccggcacggccaaggccatcagggagcgactgggccgggaaatggcggttatc
tgggtcgatgcgcatgccgatatcaacacgccggagatgagccccagcggaaacatccac
ggcatgcccatggccttcttgacccggctggcccgggaggacaagaaggatatcttcggg
tggttgcaggatgagcacatcatcaacaagaacaagctggtgtacatcggcctgcgggat
gtggaccgcggcgagaagcagctgctgcgggagcacggtatcaaggcatttagcatgcat
gacatcgacagacatggaatcggccgcgtggttgaaatggcgctcgctcacatcggcaac
gacacccccatccatctctcgttcgacgttgacgccttggaccctcaatgggctcctagc
acaggcactcccgtccgtggaggtctgactctgcgtgagggtgacttcatctgtgaatgt
gttcacgagactggcaatttgatcgccatggatctggtagaggtcaaccccagcctggac
gaagtcggtgcttcagagaccattcgagccggttgctctttggtgcggtgcgcactgggc
gacacactgctgtga

DBGET integrated database retrieval system