KEGG   Aspergillus fumigatus: AFUA_3G11780Help
Entry
AFUA_3G11780      CDS       T01017                                 

Definition
beta-N-acetylglucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
afm  Aspergillus fumigatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_3G11780
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    AFUA_3G11780
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFUA_3G11780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 814 aa AA seqDB search
MLQEDLRKKAGQLFAVGFHGVVPSPEIKTLIHEYGIGGIVLFKRNIQNAMQLQLPGPMAL
GATHSPELAYQVGQVTGETLRFFGINMNYAPVCDINSEPLNPVIGPRSPGDDPEFVGRFA
SAAAQGLREQKIIPSVKHFPGHGDTAVDSHYGLPVIEKTREQLERCELIPFRRAVAEGVE
AVMTAHISLPAIGDGKLPATLSADVLSILRNEMQFEGMIITDCLEMDGIRATYGTEQGAV
LSLEAGSDSIMICHTYAVQVASIQKVCEAVQSGQLSASRLEEAYRRVVKLKSKFLSWDTA
LLTRSLDDLVTLNRKAATLASNAYSLSVTLVRSDPDVLPLSKSGHLVLLFPGERTPAGGA
VDGEGLRMKGAYDATVFGEALKAHNQATVELHYGSAELSTEQYKLVEAADAVVLVTFNAR
ESPFQREMGLKLAQHTRKLVTIAACSPYDFLDDDSIKTYITTYEPTIEAFTAAANILFGA
IIPKGALPVGSKNVALSSVHVSPFEAASDLAELAEVWNTALPTYPLPADSLHRFLTQANG
HHFVARLESKIIGFCVMYMTTNRGTTCCQLAVLAVHPSYQRQGVGTALIAEARTWLMKNY
KPCSLSLGSSFPRFWPDIPTDLGQEVQGFFVHRGFHLNPLIPRSVDLYQDIKDFQPPEKY
VARAKERGFTFAPLQPQQYEECLAGQKRNFSYNPAWVDMYHKLDPKEHPSSIMTAFDSHG
KQVGWTLMLSPSSPVLQQNWAFPPLCGPKTGLIGCVGVDEEYRKAGVGLALLCHAIEDMK
QRGVEGVFVDWVSLEGWYEQLGFKIWRSYRTGQM
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagaagatctacggaaaaaagctggccagctttttgcggtcggctttcatgga
gttgtgccgagtccagagatcaagactttaatccacgagtacgggataggtggcattgtc
ctgttcaaacggaatattcagaatgcaatgcagctccagctaccgggaccaatggccctg
ggagccacccattcgccagaattggcgtatcaggttggccaggtcactggtgagacgctg
aggttcttcgggatcaacatgaattacgccccagtctgcgatatcaattcagagcccttg
aatccagtcataggcccccggagccccggagacgacccagaatttgttggtcggtttgca
agcgctgctgcgcaaggacttcgagaacaaaagatcatccccagtgtcaagcatttccct
ggacacggagatactgcggtggactcccattacggtcttccagtgatagaaaagacgaga
gagcaactggagagatgcgagctgatccccttccgtcgagctgtggcagagggcgttgag
gcagtgatgacggcgcatatctccttacctgccatcggtgacggcaaactgcctgccacg
ctctccgctgatgtcttgagcattctccgcaatgagatgcagtttgaagggatgattatt
acagactgcctcgagatggacgggattcgagccacgtacggtactgaacagggagcagtt
ctctccttggaagctggtagtgacagtatcatgatatgccatacgtatgctgtccaagta
gcctcaatccagaaagtctgcgaggctgtacagtctggtcagctatcagcttcacgtcta
gaggaagcataccgccgcgtggtcaagttgaagagcaagtttctaagctgggatacagcg
ctcctaacgcggagtctcgatgatctggttacgttgaacaggaaagctgccacactggca
agcaacgcctattcgctttcagtcacccttgtccgcagtgatcctgacgtcttgcctcta
tcaaagtcgggacaccttgtactgctgttcccaggggaaagaacccctgcaggaggtgca
gttgacggggagggtttaagaatgaaaggcgcttacgatgctacggtgtttggcgaggcg
ctgaaagctcacaatcaagcaactgttgagcttcactatggctctgcagaactatcgact
gagcaatacaagcttgtcgaagcggctgatgctgttgttctcgtcaccttcaatgcacga
gagtcgccctttcagagagagatgggcctgaagctcgctcagcacactcgaaagctggtt
accatagccgcttgcagtccttacgactttttggacgatgacagcatcaagacgtatata
actacctacgagccgactattgaggctttcacggccgcggcaaatattcttttcggtgcc
ataatcccaaagggtgccctaccggttggatcaaagaatgtcgcgctcagttctgtccat
gtgtcgccgtttgaagccgcaagtgatctggctgaactggcggaagtctggaatactgcc
ctgccgacatatccactgccagcggacagtcttcacaggtttttgactcaggccaacgga
catcacttcgttgctcgactagaatcaaagatcatcggcttctgcgtcatgtatatgaca
actaaccgaggcacgacgtgctgtcagctggctgtcctcgcagtccaccccagctaccaa
cgccagggtgtgggcacagccttgatcgcagaagcgcggacgtggcttatgaagaattac
aaaccatgttctctatcccttggaagctcattcccacggttctggcctgacattccgaca
gatctcgggcaagaagtacaagggttcttcgttcaccgcggtttccatctcaaccctctg
attccaagatcagtcgacctgtaccaggatattaaagatttccagcccccagaaaagtac
gtcgcgcgtgctaaagagcgcggcttcactttcgcccctcttcagccccagcagtatgaa
gagtgtctagccggccaaaagaggaacttctcctacaatccggcctgggtcgacatgtac
cacaagcttgatcccaaagagcacccctccagcatcatgactgcgttcgactcgcatggg
aaacaagtaggttggacgctgatgctgtcaccgtcgtcgccagtcctacagcagaactgg
gccttcccacccctctgtggccccaagaccgggctgatcggctgcgttggagtcgatgaa
gaatatcgtaaggcaggagtcggacttgctctcctctgccacgcgatcgaggacatgaag
caacgtggagtcgaaggagtctttgtggattgggtcagtcttgagggatggtacgagcag
ctcgggttcaagatctggcgcagctatagaaccggccagatgtag

DBGET integrated database retrieval system