KEGG   Aspergillus fumigatus: AFUA_3G12270Help
Entry
AFUA_3G12270      CDS       T01017                                 

Definition
glutathione peroxidase Hyr1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
afm  Aspergillus fumigatus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AFUA_3G12270
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AFUA_3G12270
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AFUA_3G12270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 235 aa AA seqDB search
MVLLPSSLSPPSIIFRCSPLPYISRQSPINRLSSTRAPSLLIRTMASATTFYDFKPADKK
GEPFDLASLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHPEDFTILGFPCNQFGSQ
DPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWMKEMMPGLMGLKRVKWNFEKF
LISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKGEGEATAQAKLS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggtattattgccttcatcactatcgcctccttccattatatttcgctgttcccctttg
ccatatatttcgcggcaaagtcccataaacagactttccagcactcgagcgccttccctt
ctcatcaggacaatggcctccgcgacgacattctacgatttcaagcctgccgacaagaag
ggcgaacccttcgacctcgcctccctcaaaggcaaagtcgtcctcgtcgtcaacaccgcc
tccaaatgcggcttcactcctcaatttaaaggcctcgagaacctctaccagtccatcaag
gccaagcatcccgaagacttcaccattcttggcttcccctgcaaccaatttggcagccaa
gaccccggctctaacgacgagatccagtccttctgccaggtcaactacggcgtcaccttt
cccgtgttgggcaagttggatgtcaacggcgacaatgcggcgcccgtgtggacatggatg
aaggagatgatgcctggacttatggggctgaagcgcgtcaagtggaatttcgagaagttc
ttgatttccgccgatgggaaggtcgttgggcgctgggctagtattaccaagcctgagtcg
ttggaagcaacaatcctgaaggagattgagaaagcgaagaaggaggggacggccgcttcg
acgaggaagggtgagggagaggctaccgcgcaggctaagttgtcgtag

DBGET integrated database retrieval system