KEGG   Aspergillus fumigatus: AFUA_3G13240Help
Entry
AFUA_3G13240      CDS       T01017                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afm00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afm00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 460 aa AA seqDB search
MNTSPVFNRRTPPLCDCFRSLLCPARITPRVLIIYCSFFITITILLGLRMHVKHYLSAVL
YGLPVLAQSTQSSSSSSSSTSATDPFKVYTISAENITAKLIPYGARLISLMVPDRDGKEQ
DVVIGYDDPKAYLNDTETVHTFFGAVVGRYANRIKNGTFTIRSNEYHVPKNENNGIDTLH
GGKVGYDQRNWTVTAHSKSSVTFTLYDQGWEDFPGDVITHAVYSVDTAVTPQNPKGLPQL
TTKLISLALTEATPIMLSNHIYWNLNAFKAPNVLNDTFLQLPYSNRLIATDGILIPNGTI
LTVDAFNGAPDFTEGKLIGADLKDTYGMCGTDCTGYDTCWLVDRPPQYAAPDSLVPIVRM
NSSATGISLEVSSNMPALQIYTCDNAKMDYLPIKPSQEKRNKEEGKEGAKNVMQYGCVVI
EPEGWIDGINHPEWGQLPLQIFSPNDGPAVNWATYQFGTV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttctccagtatttaaccgacgcacaccccctctttgtgactgctttcgttct
ttgctgtgtcctgctcggataacgcctcgtgtcttgatcatttactgctcctttttcatc
actatcactattctcctggggctcaggatgcatgtcaagcactatctctcggccgtcctt
tatggactgccagttttggctcagagtacacagtcgagctcctcttcttcgtccagcact
tcagctacagatcccttcaaggtctacaccatcagcgcggagaacatcactgccaagctg
attccctatggagctcgactgatatctctgatggtcccggatcgcgatggcaaggagcag
gatgttgtcattggctatgatgaccctaaggcctacctgaatgatacagagacagtccac
accttcttcggtgctgttgtgggtcggtacgccaatcgcatcaagaacggcacgttcacc
atccgcagtaatgagtaccatgtcccgaagaatgagaacaacggcatcgacactctccac
ggaggcaaggtaggctacgaccaacggaactggactgtgacagcacattccaagtcttcc
gtcaccttcactctctacgatcaaggttgggaagactttcctggagacgtcatcacccac
gccgtctacagtgtcgacacggctgtcactccacaaaacccaaagggtctcccccagctg
accaccaaactgatctcccttgccctgacggaggcgactccaattatgctctccaaccac
atctactggaatctcaatgccttcaaggcccctaatgtcctaaatgacaccttcctgcaa
ctcccttactccaaccgcctcatcgccacagatggcatcctcatccccaatggcaccatc
ctcacggtcgacgcgttcaacggcgcccccgatttcaccgagggcaagctcatcggcgcc
gatctcaaggatacctacggcatgtgcggcaccgactgcaccggctacgatacctgctgg
ctcgtcgaccgaccccctcaatacgctgctccggactcgctcgtccctatcgttcgcatg
aactccagcgcaaccggtatcagccttgaagtatcgtccaacatgccagcgcttcaaata
tacacctgcgacaacgccaagatggactacctccccatcaagccgtctcaggagaagcgt
aacaaggaagagggcaaggaaggcgcaaagaatgtcatgcaatatggctgcgtggtcatc
gagcccgagggctggattgatggcatcaaccaccctgaatgggggcaattgccactgcag
atcttctctcccaacgatggtccagctgtcaactgggctacttatcaattcggcactgtc
tag

DBGET integrated database retrieval system