KEGG   Aspergillus fumigatus: AFUA_3G14060Help
Entry
AFUA_3G14060      CDS       T01017                                 

Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AFUA_3G14060
  Lipid metabolism
   00062 Fatty acid elongation
    AFUA_3G14060
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AFUA_3G14060
Lipid biosynthesis proteins [BR:afm01004]
 Fatty acid synthase
  Component type
   AFUA_3G14060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 333 aa AA seqDB search
MIKLRAHTHMPMHYLTSLLPLTLTILSAASPLRPHETELTPLPLVIWHGLGDNFQRDGMK
EVAALAESTNPGTYVHLIHLGDTASADRQATFIGNLTEQIALVCDQLRADPILSTAPAVN
ALGFSQGGQFLRGYVERCNDPPVRNLVTFGSQHNGIAEFQECAWSDWICRGAEALLRAGR
WSSLAQSRFVPAQYFRDPEELDAYLEHSNFLADINNERVLKNKRYAENLAGLNRFAMYMF
EDDTMVNPKESAWFAEVNRTNGEVTPLKERRLYKEDWLGLKALDEQGKLDFRTVPGGHMQ
LAEETLEKVFKEYFGPVEVEIPPVNTLLKQTGL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgagagcacatacacacatgccgatgcactatctaacgagcctcctcccc
ctcaccctcacaatcctctccgcagcatctcccctccgcccccatgaaacagaactcacc
cccctcccgctcgttatctggcacggtctcggcgacaacttccagcgcgacggcatgaaa
gaagtcgccgcgctcgccgagtccacaaaccccggaacctacgtccacctcattcacctc
ggcgacaccgccagcgccgaccgccaggccaccttcatcggcaatctcactgagcaaatc
gcgctcgtctgcgaccagctccgcgcggatccgatcctttcgaccgcccccgcggtcaat
gcgctgggcttctcgcaaggcgggcagttcttgcgcgggtacgtcgaacgctgcaacgac
ccgcccgtccgcaacctcgtcaccttcggcagccagcacaatgggatcgccgagtttcag
gagtgcgcgtggagtgattggatctgccggggggcggaggcgctgctacgcgcaggccgg
tggtcgagtctcgcgcagtcacggttcgtgcctgcgcagtacttccgcgatccggaggag
ctggatgcgtacctcgagcatagcaatttccttgcagacataaacaacgagcgtgtgctg
aagaataaaaggtacgcagagaatctggcggggttgaatcgctttgcgatgtatatgttt
gaggacgataccatggtgaatccgaaggagagtgcgtggtttgcggaggtgaataggacg
aacggcgaggtgacgccgctcaaggagaggcggttgtataaggaggactggctggggtta
aaggcgctggatgaacagggaaagctggactttaggactgttcccggtggccatatgcag
ctagctgaggagaccctcgagaaggtgttcaaggagtattttgggccggttgaggtggag
attcctccggttaatactctgctcaagcagactggcttgtag

DBGET integrated database retrieval system