KEGG   Aspergillus fumigatus: AFUA_4G00960Help
Entry
AFUA_4G00960      CDS       T01017                                 

Definition
6-phosphofructokinase alpha subunit (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_4G00960
   01230 Biosynthesis of amino acids
    AFUA_4G00960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_4G00960
   00030 Pentose phosphate pathway
    AFUA_4G00960
   00051 Fructose and mannose metabolism
    AFUA_4G00960
   00052 Galactose metabolism
    AFUA_4G00960
  Energy metabolism
   00680 Methane metabolism
    AFUA_4G00960
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AFUA_4G00960
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFUA_4G00960
Protein phosphatases and associated proteins [BR:afm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFUA_4G00960
Messenger RNA biogenesis [BR:afm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AFUA_4G00960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 808 aa AA seqDB search
MSSTQAPVEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSDCEAYAVFEGYEGLVHGG
HMIRQLHWEDVRGWLSKGGTLIGSARSMAFRERAGRLKAAKNMVLRGIDALVVCGGDGSL
TGADVFRSEWPGLLEELVKNGELTEEQIEPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCSIITKNRKERGKRRTIVIVAEGAQDRSLNKISSSTVKDILTQRLGLDTRVTVLGHTQR
GGPACAYDRWLSTLQGVEAVRAVLDMKPDSPSPVITIRENKIMRTPLVDAVQETKHVAKL
IHDKDFEAAMRLRDAEFKEYHFAYRNTATPDHPKMILPQDKRMRIAIIHVGAPAGGMNQA
TRAAVGYCLTRGHTPLAIHNGFPGLCRHHDDQPVGSVREVKWLESDAWVNEGGSDIGTNR
SLPSEDFETTAMCFEKYKFDALFVVGGFEAFTAVSQLRQARDKYPAFKIPMVVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAT
AVYIPEEGIDIKMLSNDIDFLRENFARDKGANRAGKLILRNECASSTYTTQVIADIFKEE
AKGRFESRSAVPGHFQQGGKPSPMDRIRALRMAVKCMLHLENYAGKSRDEIAADPMSAAV
IGIKGSQVLFSAMGGEDGLEATETDWARRRPKTEFWLELQNYVNVLSGRASAGKPLWSCY
ESKHFPSCCRLYNTDLSIDIDPSALTSS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaacacaagcacccgtcgagccacccaagagacgccgcattggtgtcctcacc
tcgggtggtgatgcccccggtatgaacggagccgtacgggccgttgtccgtatggccatt
tactccgactgcgaagcgtacgcagtgttcgaaggttatgagggattagttcatggtggc
catatgattcgtcagctgcactgggaagatgttcgtggctggctgtccaagggtggtaca
ctgatcggatctgctcggagcatggcttttcgtgaacgtgctggacgtctcaaggctgct
aagaacatggtgctccgtggaatcgatgctctggttgtctgcggtggtgacggaagtctg
accggggcagacgtcttccgttcggaatggcccggtttgctggaggagctggtcaagaat
ggtgaattgacggaggaacagatcgaaccgtacaaggttttgaacattgttggcttggtt
ggttcaattgacaacgacatgtccggcactgacgccacgatcggctgctattcctctctg
acacgaatttgcgatgccgtcgatgatgttttcgatactgcgttttcccaccagcgaggt
ttcgttatcgaggttatggggcgacactgcggttggttagctttgatgtctgcgatcagc
accggcgcggactggttgttcattccggaaatgcctcctcgtgacgggtgggaggatgac
atgtgctcgatcatcaccaagaaccgcaaagaacgtggcaagcgtcgcactattgttatc
gtcgccgaaggtgctcaggatcgcagtctcaacaagatttccagctcaacggtcaaggac
attctcacacagcgacttggactggataccagagttactgtactaggacacactcagaga
ggaggaccagcatgcgcatatgaccggtggctgtccaccttgcaaggcgttgaagccgtc
cgggctgttctggatatgaagccggactcgccatcgccagtcattaccattcgtgagaac
aagatcatgcggacaccgctggtggacgcagtgcaagaaaccaagcatgtagcgaagctc
atccatgacaaggactttgaggcagcgatgagactgcgggacgccgaatttaaagaatat
cactttgcctatcgcaacactgccacacctgatcatcccaagatgatcctccctcaagac
aagagaatgagaattgccatcatccacgtcggtgccccggctggcggcatgaaccaagcc
acccgcgccgctgtcggttactgcctcactcgtggacacaccccgcttgcgattcacaac
ggtttccccggcctttgccgtcaccatgatgatcaacccgtcggctctgttcgtgaagtc
aagtggctggagtctgatgcttgggttaacgaaggtggatcggatattggcacaaaccgt
agcctaccgtccgaggatttcgagaccactgccatgtgcttcgagaagtacaagtttgac
gcactgttcgtggtcggtggtttcgaggcttttacagcagtcagtcagctccgtcaggcc
cgcgataagtatcccgctttcaagattccgatggttgtgttgcccgctacgatttcgaac
aatgtgcctggaaccgagtactcgctgggaagcgacacctgtctcaacactttgattgat
ttctgcgacgccatccgccagtcagcgtcgtcctctcggcgtcgtgtcttcgtcatcgag
acacaaggtggtaagtcgggctacatcgccactaccgctggtctcgccgtcggcgctaca
gccgtgtacattcccgaagagggcatagacattaagatgctctcgaacgacattgacttc
ctgcgggagaactttgcccgtgataagggagccaaccgtgcaggaaagctcatcctgcgc
aatgaatgtgcctccagcacctataccacacaggtcatcgccgacatcttcaaggaggag
gccaagggtcggttcgagtctcggtcggcggtccctggccacttccagcaaggaggtaag
ccatcgccgatggaccgtatccgcgctctccggatggcggtcaagtgtatgctgcatctc
gaaaactacgcaggcaagtcgcgcgacgagatagcagcggacccaatgtcggcggcggtc
atcggtatcaagggctcgcaggtgttgttctccgctatgggcggcgaggacggtctggag
gcgacggagacggattgggcacgccggcgtcccaagacggagttctggctggagcttcag
aactatgttaacgtcctgtctggccgtgcttctgcgggaaagcccttgtggtcatgctat
gagagtaagcacttccccagctgttgtcgcctttacaatactgacttgtctatagacatt
gatccttcggcgctcacttcatcttag

DBGET integrated database retrieval system