KEGG   Aspergillus fumigatus: AFUA_4G00960Help
Entry
AFUA_4G00960      CDS       T01017                                 

Definition
6-phosphofructokinase alpha subunit (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:afm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:afm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:afm00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 808 aa AA seqDB search
MSSTQAPVEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSDCEAYAVFEGYEGLVHGG
HMIRQLHWEDVRGWLSKGGTLIGSARSMAFRERAGRLKAAKNMVLRGIDALVVCGGDGSL
TGADVFRSEWPGLLEELVKNGELTEEQIEPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCSIITKNRKERGKRRTIVIVAEGAQDRSLNKISSSTVKDILTQRLGLDTRVTVLGHTQR
GGPACAYDRWLSTLQGVEAVRAVLDMKPDSPSPVITIRENKIMRTPLVDAVQETKHVAKL
IHDKDFEAAMRLRDAEFKEYHFAYRNTATPDHPKMILPQDKRMRIAIIHVGAPAGGMNQA
TRAAVGYCLTRGHTPLAIHNGFPGLCRHHDDQPVGSVREVKWLESDAWVNEGGSDIGTNR
SLPSEDFETTAMCFEKYKFDALFVVGGFEAFTAVSQLRQARDKYPAFKIPMVVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAT
AVYIPEEGIDIKMLSNDIDFLRENFARDKGANRAGKLILRNECASSTYTTQVIADIFKEE
AKGRFESRSAVPGHFQQGGKPSPMDRIRALRMAVKCMLHLENYAGKSRDEIAADPMSAAV
IGIKGSQVLFSAMGGEDGLEATETDWARRRPKTEFWLELQNYVNVLSGRASAGKPLWSCY
ESKHFPSCCRLYNTDLSIDIDPSALTSS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaacacaagcacccgtcgagccacccaagagacgccgcattggtgtcctcacc
tcgggtggtgatgcccccggtatgaacggagccgtacgggccgttgtccgtatggccatt
tactccgactgcgaagcgtacgcagtgttcgaaggttatgagggattagttcatggtggc
catatgattcgtcagctgcactgggaagatgttcgtggctggctgtccaagggtggtaca
ctgatcggatctgctcggagcatggcttttcgtgaacgtgctggacgtctcaaggctgct
aagaacatggtgctccgtggaatcgatgctctggttgtctgcggtggtgacggaagtctg
accggggcagacgtcttccgttcggaatggcccggtttgctggaggagctggtcaagaat
ggtgaattgacggaggaacagatcgaaccgtacaaggttttgaacattgttggcttggtt
ggttcaattgacaacgacatgtccggcactgacgccacgatcggctgctattcctctctg
acacgaatttgcgatgccgtcgatgatgttttcgatactgcgttttcccaccagcgaggt
ttcgttatcgaggttatggggcgacactgcggttggttagctttgatgtctgcgatcagc
accggcgcggactggttgttcattccggaaatgcctcctcgtgacgggtgggaggatgac
atgtgctcgatcatcaccaagaaccgcaaagaacgtggcaagcgtcgcactattgttatc
gtcgccgaaggtgctcaggatcgcagtctcaacaagatttccagctcaacggtcaaggac
attctcacacagcgacttggactggataccagagttactgtactaggacacactcagaga
ggaggaccagcatgcgcatatgaccggtggctgtccaccttgcaaggcgttgaagccgtc
cgggctgttctggatatgaagccggactcgccatcgccagtcattaccattcgtgagaac
aagatcatgcggacaccgctggtggacgcagtgcaagaaaccaagcatgtagcgaagctc
atccatgacaaggactttgaggcagcgatgagactgcgggacgccgaatttaaagaatat
cactttgcctatcgcaacactgccacacctgatcatcccaagatgatcctccctcaagac
aagagaatgagaattgccatcatccacgtcggtgccccggctggcggcatgaaccaagcc
acccgcgccgctgtcggttactgcctcactcgtggacacaccccgcttgcgattcacaac
ggtttccccggcctttgccgtcaccatgatgatcaacccgtcggctctgttcgtgaagtc
aagtggctggagtctgatgcttgggttaacgaaggtggatcggatattggcacaaaccgt
agcctaccgtccgaggatttcgagaccactgccatgtgcttcgagaagtacaagtttgac
gcactgttcgtggtcggtggtttcgaggcttttacagcagtcagtcagctccgtcaggcc
cgcgataagtatcccgctttcaagattccgatggttgtgttgcccgctacgatttcgaac
aatgtgcctggaaccgagtactcgctgggaagcgacacctgtctcaacactttgattgat
ttctgcgacgccatccgccagtcagcgtcgtcctctcggcgtcgtgtcttcgtcatcgag
acacaaggtggtaagtcgggctacatcgccactaccgctggtctcgccgtcggcgctaca
gccgtgtacattcccgaagagggcatagacattaagatgctctcgaacgacattgacttc
ctgcgggagaactttgcccgtgataagggagccaaccgtgcaggaaagctcatcctgcgc
aatgaatgtgcctccagcacctataccacacaggtcatcgccgacatcttcaaggaggag
gccaagggtcggttcgagtctcggtcggcggtccctggccacttccagcaaggaggtaag
ccatcgccgatggaccgtatccgcgctctccggatggcggtcaagtgtatgctgcatctc
gaaaactacgcaggcaagtcgcgcgacgagatagcagcggacccaatgtcggcggcggtc
atcggtatcaagggctcgcaggtgttgttctccgctatgggcggcgaggacggtctggag
gcgacggagacggattgggcacgccggcgtcccaagacggagttctggctggagcttcag
aactatgttaacgtcctgtctggccgtgcttctgcgggaaagcccttgtggtcatgctat
gagagtaagcacttccccagctgttgtcgcctttacaatactgacttgtctatagacatt
gatccttcggcgctcacttcatcttag

DBGET integrated database retrieval system