KEGG   Aspergillus fumigatus: AFUA_4G03000Help
Entry
AFUA_4G03000      CDS       T01017                                 

Definition
Patatin-like serine hydrolase
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
afm  Aspergillus fumigatus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:afm00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1522 aa AA seqDB search
MADGVTQVDSTGLHSFSPSPSLSSSSSLPAVALSLAVSASAVTASYSISHLPPPPLPPVP
TTMAGWIGWVFSFFFQVIPSVLYWIITFSTITLPTWLFTLFSMSLTFTMNFTTLLLIVLA
VVSTISWFIRYRFLNMYSRLPPEPQRKEPQVDLFPDVQEGDSKPGLANYLDEFLSAIKVF
GYLERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLVQIFVKSMRDGKSDTDEEL
HHLGAESSDEEHHIDGKQGYQLLTEVKNGASMSSLFSILSLFTEDIQLRENESSGSSSSS
IALRAARVPNSIPTSPRGVMDSPSLGFQDHSDDTSNMITNGELPSVPPLHLGESRTPPSG
DQHHQQHHESRKHSSRKRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPRATAHIVQ
VILTRLQRVTFATAHSYLGLSNEVLGIEKQMTKFTTYDLPNNMRGAALDRLKDKFIKERD
RLGSEEVTKGIALHNPSAGRRRRSSSFLRKDAALQAKLMTPRRAATVVTPESAPAEHDTY
GVSPGDLLSTIQSSRFGPRYEQPPAKLQTPLAEKENTHFRLPAMQARHTFRRQDTMDEDG
LFRECILDCIMKGIGLTSSTRDALRKSNHSGEASPKLLSYDSRRQKAIFTNNAFGFIDPY
EGSGDGETESLMSMSVTSAGGTSPVINLREELRNDIEIVYFPKGSVLVEQGERHPGLYYV
IDGFLDVGVPIVDKGEDLVGVSKPAASKGSFPTLKRTTTANSVGAGGTAANDSRRRKQSR
KSLYLIKPGGIQGYVGAVASYRSYTDVVAKTDVYVGFLPRASLERIAERYPIALLTLAKR
LTSILPRLLLHIDFALEWVQVNAGQVIYRQGDESDAIYLVLNGRLRSVLESPGNKLAVVG
EYGQGESVGELEVMTESTRPATLHAIRDTELAKFPRSLFNSLAQEHPGITIQVSKLIAQR
MRDLVERPVTEKGVERSNAGSVQTATSTVNLRTVGILPVTAGVPVVEFGNRLLHALHQVG
VTNGVTSLNQAAILNHLGRHAFSKMGKLKLSQYLADLEEKYGMVLYIADTNVSSPWTQTC
ITQADCILLVGLAESSPSIGEYERFLLGMKTTARKELVLLHAERYCPPGLTRRWLKNRVW
INGGHHHIQMAFRLTAEPTHPETKRFGTVLKQRVQVLQAEIQKYTSRRIRQTPLYSAQSP
FKGDFHRLARRLCGRAVGLVLGGGGARGIAHVGVIKALEEAGIPVDIIGGTSIGSFIGAL
YARDADVVPMYGRAKKFAGRMGSMWRFALDLTYPTVSYTTGHEFNRGIFKTFGDSQIEDF
WLEFYCNTTNISKSRPEYHSSGYVWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVD
HMKGLGADVIFAVDVGSIDDNTPQVYGDSLSGFWSVFNRWNPFSSCPNPPTLSEIQARLA
YVSSIDNLERAKNIPGCLYMRPPIDGYGTLEFGKFDEIYQVGYAFGKQFLEKLKSEGSLP
LPEETEEKKKLQRTLAPRRASI
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggagtgacacaggtcgactctactggcctgcattcattttctccttcccct
tctctgtcttcctcctcctccttacctgccgttgcactgtctctcgcagtgtctgcttcc
gccgtaaccgccagctatagcatctcccatcttcctcccccgcctttacccccagtgcct
acaactatggcggggtggatcggatgggttttttccttctttttccaggtcattccaagc
gttctatactggatcatcactttttctaccatcacgttgcccacatggctgttcacactc
ttttccatgagcctgacgttcacaatgaacttcacgacgcttttgttaatcgttctggcg
gtggtttcgaccatcagctggtttattcggtatcgctttctgaacatgtacagtcgatta
cctcccgagccccaacggaaggaaccgcaggttgatctcttccccgatgtacaagaagga
gattcgaagccagggctggccaattacctggacgaattcctcagcgctatcaaagttttt
gggtacttggaacggcccgtcttccacgaattgacccggacaatgcaaaccaggaagctg
atcgcaggcgaaacgcttatgttggaggaagaaaagggattctgtctagtagtcgacggg
ttggtccagatctttgtcaagtccatgcgagacggaaagtcggacacagatgaggagctg
caccatctcggagccgaatcctcggacgaggaacaccatatcgacggcaagcagggatac
caattgctgaccgaggtcaagaacggcgcgtcgatgtcgtccttattctcaattctctcg
ctgttcacagaggacattcaattacgagagaacgagagctcaggctccagttcctccagc
atcgcccttcgcgctgctcgcgtacccaactcaatcccaacgagccctcggggagtgatg
gatagcccttccttgggctttcaagaccacagcgacgatacctctaatatgatcaccaac
ggagagctgccatccgtgcccccgctgcatctgggagagagccgcactcctccttctggt
gaccagcaccatcagcagcaccatgaaagtcggaagcactctagcagaaaacgccggaag
tcggtccaccctgacattgttgcccgtgctatggtggataccacaatcgcaatcatccca
gccagcgctttccggcgactgaccagggtctacccaagggcaaccgcccacatcgtccag
gtcatcctcacccgccttcagagagttacgtttgcaacggcacattcctatcttggtctc
agcaacgaggtgcttggaattgaaaagcaaatgaccaagtttaccacgtatgatctgcca
aataacatgcgcggcgcagctctggatcgcctcaaagacaagttcatcaaggagcgggat
cgcctaggctctgaggaagtcacgaagggaattgccctgcacaatccatctgcgggtaga
cgacgccggtcgagcagcttcctgagaaaggatgctgcgctgcaagccaagctgatgaca
cccagacgtgcggccaccgtggttaccccggagagtgcacccgctgagcacgacacatat
ggagttagtccaggcgacctattatcgaccattcaatcctccagattcggccccaggtat
gagcagcctcctgcaaaactacagactcctttggctgaaaaggagaacacccatttccga
cttcctgccatgcaagcgcgtcatactttccgccgacaagacaccatggacgaggacgga
ctgttccgcgagtgcatcttggactgcatcatgaagggaatcggcctcacgagtagtact
cgtgacgctttgcgcaaaagcaaccattctggcgaggcttctccgaagctcctttcctat
gattctcgacgtcagaaggcgatcttcaccaacaacgcctttggctttattgacccatac
gaaggctctggggacggggagacggagtcgctgatgtccatgtctgtaacgagtgcagga
ggcacatcgccagtgatcaacttgcgggaagagctccgtaacgacatcgagatcgtctat
ttccccaagggttcggttttggtcgagcagggagagcgccacccagggttgtactacgtg
attgatggattcttggacgtcggcgtgccgattgtcgacaaaggggaggacctcgtgggt
gtctccaagccagcagcttcgaaggggtcgttcccgacccttaagcggacgacaaccgcc
aactcggttggagcgggcggcacagctgccaacgattctcgccgaagaaagcaatctcgg
aagtccctgtatctgatcaaacccggcggtattcaaggctacgtcggagcagtagcgtcc
tatagatcttacaccgacgtcgttgctaagacggacgtctatgttggctttctcccacgg
gcgtccttggagcgcatcgcggagcggtatccgatcgctctgctgacgcttgcgaagagg
ctgacaagtatccttccacgcctgctcctccacatagattttgctctcgaatgggtacag
gtgaatgccggccaagttatctaccgccaaggcgacgagagcgacgcaatttatcttgtt
ttgaatggacgattacggtcagtccttgaaagtccaggcaacaaattagccgtcgttggc
gaatacggccaaggagaaagcgtgggtgagctcgaagtgatgaccgagtccactcggccg
gctactcttcatgcgatccgtgataccgagttggccaagttcccacgatcgctcttcaac
agccttgcccaggaacacccaggaattaccattcaggtctctaaactgattgcgcaacgg
atgcgggatctagtcgaacgcccggtgactgagaaaggcgtcgaacgaagcaacgctggc
agtgtgcaaaccgcaacctcgaccgtcaatctccggaccgtgggcattctgcctgtgaca
gctggcgttccagtggtcgaattcggtaatcgactattgcacgctcttcatcaagttgga
gtgacgaatggggttacatctctcaaccaggcagccattttgaatcacctagggcgccat
gccttcagcaagatgggcaagctcaagttgtcccaataccttgccgatctagaagagaag
tatggcatggttctttacatcgctgacactaacgtgagctctccatggacgcaaacatgc
atcacgcaggccgattgcattcttctggtcggtctggccgaatcatcccccagtattgga
gagtacgagaggttcctgcttggcatgaagaccacggctcggaaagagctcgtattgttg
catgcggagcggtattgtccgcctggactgactcgacgttggttgaagaaccgagtctgg
atcaatggcggccaccatcacattcagatggccttccgactgacggccgagcctacgcat
ccggaaaccaagcgcttcgggacagtcctcaaacaacgggtccaggtgttgcaggctgaa
atccaaaagtacacgtcgcggaggattcgccagacacctctgtactctgcccaatcccca
ttcaaaggtgatttccatcgtcttgcgcgtcggctgtgtggtagagctgttggtttggtg
cttggtggaggaggagcaaggggtattgcgcacgttggtgtgatcaaggcgctcgaagag
gccggtatccccgttgatatcatcggcggcacatcgatcggttcctttatcggtgcattg
tatgctcgcgatgcagacgtggttcccatgtatggccgtgcgaagaagtttgctggtcgc
atgggaagcatgtggcggttcgcgctggatctgacttacccgacggtctcgtacacgacc
ggccacgagttcaaccgtggaatcttcaagacctttggggatagccagatcgaggacttc
tggctcgagttctactgcaacactaccaacatcagcaaatcgcgccccgagtaccattcg
tctggatatgtctggcgttatgtgcgtgcatccatgtcgcttgcgggtctgattccgccg
atttgcgacgagggaagcatgctcctcgacggcggctacattgacaatctgaccgtcgac
cacatgaagggtctcggtgcggatgtgatcttcgccgttgacgtcggttctattgacgac
aacacacctcaggtctacggagactccctctccggattttggtccgtctttaaccgctgg
aacccgttctcctcgtgccccaatccacccacgctatccgaaatccaggcacgcctggcc
tacgtctcgtctattgacaacctggaacgcgccaagaatatcccgggctgtctgtacatg
cgtccccctatagatggatacggcacgctggagtttggcaagtttgatgagatctaccag
gtcggatatgcctttggcaagcaattcctggagaagctgaagtccgaagggtccctcccc
ttgccagaggagaccgaggagaagaagaagctgcaacgtacactcgctccccgccgagcc
agtatatga

DBGET integrated database retrieval system