KEGG   Aspergillus fumigatus: AFUA_4G03050Help
Entry
AFUA_4G03050      CDS       T01017                                 

Definition
profilin Pfy1
Orthology
K05759  
profilin
Organism
afm  Aspergillus fumigatus
Brite
Exosome [BR:afm04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFUA_4G03050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 136 aa AA seqDB search
MGQHSAVWQGYVDSRAKSTSLMGSGQFDKAAILSYDFSDVEAQSPTFQISKEEIAGLKAA
FDKPGSAFETGFVVGGDKFVAIKADDRSLYGKKGKEGIVVVKAVSCVMVAHHGEAVQTTN
AATVVENLVDYINNPR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagcactcggcagtttggcaaggatatgttgattccagagccaaatctaccagt
ttgatgggctccggccagtttgacaaggccgccattctgagctacgacttctccgacgtc
gaggcccagtcccctactttccagatctcgaaggaggaaattgccgggctgaaggctgct
ttcgacaagcctggcagtgctttcgaaaccggtttcgtggtcggaggagacaagttcgtc
gccatcaaggctgatgatcgcagtctctacggcaagaagggcaaagagggtatcgtcgtc
gtcaaggccgtctcttgcgtcatggtggcccatcatggcgaggccgttcagaccaccaac
gctgcaaccgttgtcgagaacctcgtcgactacatcaacaacccccggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system