KEGG   Aspergillus fumigatus: AFUA_4G03230Help
Entry
AFUA_4G03230      CDS       T01017                                 

Definition
extracellular guanyl-specific ribonuclease RntA (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     AFUA_4G03230
Transfer RNA biogenesis [BR:afm03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    AFUA_4G03230
 Prokaryotic Type
    AFUA_4G03230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 131 aa AA seqDB search
MLYKKIIAVAALLVAPVLAAPTEFDTRACDYTCGSNCYSASAVRAAQEAGYELYSSDETV
GSNNYPHKYNNYEGFDFPVSSPYYEWPILSSGKIYSGGSPGADRVVFNSKDELAGLITHT
GASGNNFVACT
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacaagaagatcatcgccgtcgcagccctgctggtcgcccctgtccttgccgcc
cctactgaattcgacacccgcgcctgcgactacacctgcggcagcaactgctacagcgcg
agcgccgtgagagccgcccaggaagccggttatgagctctactcctccgacgagaccgtg
ggcagcaacaactacccccacaagtacaacaactacgagggcttcgacttccctgtctcg
agtccctactatgagtggcctatcctgagctccggaaagatctacagcggtggttcccct
ggtgcggaccgtgtcgtcttcaatagcaaggatgagctggctggtcttattacacatacc
ggggccagtggaaacaactttgtcgcttgcacttag

DBGET integrated database retrieval system