KEGG   Aspergillus fumigatus: AFUA_4G03850Help
Entry
AFUA_4G03850      CDS       T01017                                 

Definition
protein kinase Yak1 (EC:2.7.1.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AFUA_4G03850
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AFUA_4G03850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 894 aa AA seqDB search
MGSQWQPYQDPLMGRPAQFNNGLASTPQQLGPKYGGQPQQSQPPVGYTYEAFQTPGTAAK
PPSAGANSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNRAKYSARPNHHSRPSSQFF
SPEESSAARRYSPMNVLSPSMSYNTSPGKSQNSYAFPPGPNNSRRSPTRALNYSSPAQSF
QSPPSVSRPPRLPPLQPTEMSSDQFYPPSAGSQVNAHFGQDGRSPRSGSISGASKQAGRG
PVPKFQKIKSVQELQPRINAQPPYRRANPEGGFISPLQALTSHLPATYRICNPSFNYESS
RNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVV
KCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSKYDKNDDHHLLRLKDTFIHRQH
LCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILL
KNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELF
LGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSGEFFEKTQDEFGRKTYRLKSLEQY
SREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMKQAEIERELNNRVAFIDFVRGLLSIN
PLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYSSLNKTIPPGIQQQQQAEAASKQRAAQ
AAHAQSAAQNAYSMQMNQFHTPSHGQPPPMYNGMFAGHQQGAPPPYPAQPPGYGHQMNLM
PGQMPQSQYAPSQSLYAQATTRAGRQRASTMDHQGGGIPPTIQRVASHLDPNAPIRLQPS
PAYYPPPPDGYVDNNAQRRRGSRAGAGQRNRDFIRTLEDGVLGGDGYMNQSQWH
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcagtggcagccgtaccaggaccccttgatgggacgtcctgcgcagttcaat
aatggattggcgtctactcctcaacaattaggccctaagtatggtggtcagccacagcag
tctcagccgcccgtgggatatacctatgaagccttccaaacgcccggaacagcagcgaaa
cctccttcggccggcgcaaactccaaatcggtatctatggcgtcgtcaccagccgcaacg
ccacgtagccgcgattatgtcaccgatgccgataccaccatggaggatgcggacccgtac
aacagggcgaagtactctgcgcgaccgaatcatcatagtcgaccctcgtctcaatttttc
tctcctgaggagtcctcggccgcccgaaggtactccccgatgaatgttctgtcaccgtcc
atgtcttacaatactagtcctggaaagtctcagaactcatacgctttcccacccggacca
aacaactctcgccggtcgccgaccagagctctgaactactcctcacccgctcagtcattt
cagtcgcctccctctgtgtcacgtcctcctcggctccctccgctacagcctaccgagatg
agttccgaccaattctacccgccttcagcaggatcccaagtcaacgctcactttggacaa
gatggcagatcgccccggtcgggatccatctcgggtgcgagtaagcaagccggccgaggg
ccagtgccgaagtttcaaaagatcaagtcggtccaggagctccaacctcgcattaatgcg
cagcctccatatagacgtgccaatccagaaggtggcttcattagtccccttcaagcgtta
acctcccatcttccggccacataccgtatctgcaatccaagcttcaattacgagtcttcg
cggaatcccagacgtgtcctaacgaaaccaagcaagggagtcaaaaacgacggctatgac
aatgaggacagcgattatattctctatgtgaacgacattcttggaagcgaagaagcgggt
cacaagaatcgttacctcattctcgacgtgttgggccaggggacgtttggtcaagtcgtc
aagtgccaaaatctgaaaacccaagaggttgttgccgtgaaggtcattaagaataagact
gcatactttaatcagagtatgatggaagtctcggttttggacttgcttaacagcaagtac
gacaagaacgacgaccatcacctgcttcgtttgaaggatacttttatccaccggcagcat
ctctgtctggtttttgaattgctcagtgtcaatctttatgaattgatcaagcaaaaccag
tttcgtggtttgagcacaactctcgtccgtgtttttgctcagcaacttctcaacgcgttg
agtctgttaaacaaggcgcatctaattcattgtgatctcaagcccgagaacatattactg
aagaatcttgagagtccaattatcaaagtcatcgatttcggctctgcttgcgatgagcga
caaactgtctacacgtatatccagtcgagattctaccgttcccccgaggtgctgcttggc
ttaccttactcgtctgcaatcgatatgtggtctcttggttgcatcgttgtcgagctcttc
cttggtctgcctcttttccctggctcctccgaatacaatcaggtctgtcggattgtggaa
atgcttggtctaccaccgacgtggatgcttgaaatgggcaagcagtcaggtgaattcttt
gagaagacccaggacgagttcggtcgcaagacataccggctgaaaagcctggaacaatac
tcccgcgaacataacacgaaagaacaaccgagcaaaaagtatttccaggcttccacgctg
gaagaaatcattcggagctatccaatgcctaggaagaatatgaagcaagccgagatcgag
cgagaattgaacaatcgagttgctttcatcgactttgttcgtggactgctgtcaatcaac
cctcttgagcgatggtcgccccaacaagccaagctgcaccctttcattacgcagcagaag
tttacagggcccttcgtaccgccaatgaatctgaaatattcctcgctcaacaaaaccata
ccgcctggaatacagcagcaacagcaggctgaggctgctagcaaacagcgagctgcccaa
gcggcacatgctcagtcagcggcccagaatgcatattcgatgcaaatgaatcagttccat
acaccttctcatggccaacccccacccatgtacaacggcatgtttgccggccatcagcaa
ggcgctcctcctccatatcctgcccagccgcctggctacggccatcaaatgaaccttatg
ccaggtcagatgcctcaatcgcaatatgcaccgtctcagagtctctacgctcaagcaacc
actagagctggtcgccaacgcgcatccaccatggaccatcagggaggaggaattccgcca
actattcaacgcgttgccagtcacctggacccgaatgcccccattcgactccagcccagc
ccagcgtattacccgccacctcctgacggatatgtcgacaacaatgctcaacggcgcagg
ggaagccgtgcaggggctggtcaacgtaaccgagacttcattcggactctcgaggacggt
gtcctcggcggcgacggctatatgaaccagagccagtggcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system