KEGG   Aspergillus fumigatus: AFUA_4G04200Help
Entry
AFUA_4G04200      CDS       T01017                                 

Definition
myo-inositol-1(or 4)-monophosphatase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
afm  Aspergillus fumigatus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AFUA_4G04200
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AFUA_4G04200
Transfer RNA biogenesis [BR:afm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AFUA_4G04200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 357 aa AA seqDB search
MDSSCLYSKELQLACLTVQRAALLTKKLLEAVDKGSFDKSDSTPVTIADFAAQALIIGAI
HKAFPEDEFVGEEDSKALRADPELLERTWELASTTHLDDKDSEALLYAPKSKEEMLDLID
LGARGRCSLENRAWVLDPVDGTATFMQGQQYAVCLALVENGCQKVGVLGCPNLNLATGRL
REDVVDRDGYGSQVFAVAGQGAWIRKMGRGGLLAAESIPQRPQITDPKDLDFVDCGSATS
SNTSLHARVASKLGAPWPYSTDLWAAQLRYIAIAVGGCNALIKIPHKALYRSKIWDHAGG
MLIAEEVGVKVTDLAGNPVDCSLGRTLAGCYGMIVAPPSIHERIVEAVKEVMQEQTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggattccagctgtctttattccaaagaactacaacttgcatgcctcacggtgcaacgg
gctgcactattgacgaagaaattgctcgaggctgtcgacaaaggatctttcgacaagagt
gattccacgcctgtgaccatcgccgactttgctgcccaagcacttatcattggcgctatc
cacaaagcctttcctgaagatgagtttgtgggtgaggaagactcaaaggctcttcgtgca
gatccagaacttcttgagcgcacatgggaactcgcgtctactactcatctcgatgacaag
gacagtgaagcccttctctacgctcccaagtcaaaggaggaaatgcttgacttgattgat
cttggagctcgtggtaggtgtagcctggagaatcgtgcctgggttttggatcctgtcgat
ggtactgcgactttcatgcagggccagcagtatgcggtatgcctggcactggtggagaat
ggatgccagaaggtcggcgtgttaggttgcccgaatcttaatcttgctacgggccgtctt
cgagaggatgttgtggatcgagatggctacgggtctcaagtctttgcagttgctggtcaa
ggcgcctggatacggaagatgggacgcgggggtctgctcgctgctgagagtatccctcag
aggccacagattacggacccgaaggacctcgatttcgtggattgtgggtccgctacatca
tctaatacctctttgcatgctcgagtggcatcgaaactgggtgctccgtggccgtacagc
actgatctctgggctgcacagttgcgctacatagccattgcggtaggaggctgcaacgct
ttgatcaagatcccccacaaggcattatatcggtcaaagatttgggaccatgcaggcggc
atgttgattgctgaagaagtcggcgttaaggttactgatcttgctggaaatcctgtcgac
tgcagcttgggccgaaccctagctggatgctacgggatgatcgtggctcctccttccatt
catgaacggatcgtcgaagccgtaaaggaggtcatgcaggaacagactaagtga

DBGET integrated database retrieval system