KEGG   Aspergillus fumigatus: AFUA_4G04360Help
Entry
AFUA_4G04360      CDS       T01017                                 

Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit (Tfb2)
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
afm  Aspergillus fumigatus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AFUA_4G04360
  Replication and repair
   03420 Nucleotide excision repair
    AFUA_4G04360
Transcription machinery [BR:afm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AFUA_4G04360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 479 aa AA seqDB search
MAAAPPRPFDYLESLPGTVFNKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAAD
LEAWVRPGSLKERDNALSILGRLHIMTSTTTSDNIKAYTVTDPFASSLRQALTGAEQTQS
FGVLSQISDKEAVSIADLDEYSRRQWEGVLGYMVGTSGLGMQRDVSLSKGVKELLQAGHL
VEIRDRRVEITQDGFAFALQDVGTQVWHILVLYVESAAAIGMDSVEVLSFVFFLSSLELG
KSYEKKQLTSNQLRTLTDLADFGIVYQETPDATHFYPTRLATTLTSDSSTLSNPLAGSLS
GPTGTSSSKAGSGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSVR
RAVEMGITADQIISYLSTHAHPQMRKHNVSRSTSNQAGMPVSVLPPTVVDQIRLWQLERD
RVKATHGFLFRDFNTLAEYEAPCRYAEEIGVLVWKSDRKRMFFVTRHHQVAAFLKSRRK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcaccaccccgtcctttcgattacctggagagcttgcctggtactgtcttc
aacaagctctaccagcagccctccactgctctcgccattttcaggcgcatgctgcctgac
ctggcaaaatgtttcgtgatggcccttctctacctcaaggacccacttccagcagcggat
ttggaggcgtgggtcagaccaggcagtttgaaagagcgagataatgcgctttcaattttg
ggcaggttgcacattatgaccagcactacgacgtcggataacataaaagcatacaccgtc
accgatccttttgcatcctctcttcggcaggctctcaccggtgccgagcagactcaatcg
ttcggtgtcctgtcacagatatctgacaaagaagccgtctccattgcggatttggacgag
tattccagacggcagtgggaaggagttctgggatacatggtggggaccagtggactgggc
atgcaacgcgacgtcagtttgagcaaaggcgtgaaggagctcttgcaggcgggccacctc
gtcgagatcagggatcgtcgagtggaaattacacaggacgggttcgctttcgctctacaa
gacgttggcactcaagtgtggcatatcctagttctatatgttgagagcgccgcggccatc
ggtatggacagcgtcgaggtgctttcctttgtgttcttcctgagcagtttggaactgggg
aaatcatatgagaagaagcagttgacgtcgaaccaattgcgcactctgaccgacttggcc
gactttggtatcgtctaccaagaaaccccggatgccactcatttctacccgacgcgcctc
gcaaccaccttgacttccgactccagcactctgagcaatcctctcgctggctccctttct
ggacctacgggcacatcctcgagcaaggccggttccggattcatcatcatcgaaacgaat
taccgactctacgcatatacctcctcaccgctccagatctccctcattgcactgttcacc
acattgaaatatcgcttcccgaatttgatcacgggtaaaatcacccgccagtcagtccgt
cgtgcagtggagatgggcatcaccgccgatcaaatcatctcttacctatcaacacatgca
cacccacaaatgcgcaagcacaatgtgtccaggtcgacttctaatcaagccggaatgccg
gtgtctgtcctaccgcctaccgttgtggatcagattcgtctttggcagctcgagagagat
cgcgtcaaagcgacacatggctttttattcagggacttcaacactctggccgaatatgag
gccccgtgtcgatatgccgaggagatcggcgttctggtctggaaatctgatcgcaagcgg
atgttctttgtcactcgacatcaccaggttgctgctttcttgaagagcaggaggaagtaa

DBGET integrated database retrieval system