KEGG   Aspergillus fumigatus: AFUA_4G06290Help
Entry
AFUA_4G06290      CDS       T01017                                 

Definition
longevity-assurance protein (LAC1)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
afm  Aspergillus fumigatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afm00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 467 aa AA seqDB search
MAKDESTRSQSVSELNTCVSTSHRTAAKDATFREWMDANQIGMRLFSNLPWSWTRWLTVA
LYAYLGVSLTILGTLLAAHNLYPTLRPYTAPFFELSYYQPSEGVYVQGFDDVYFVVSSAI
TFTAVRAIAIEWIFRPAARYAGLKRKASNRFAEQAWMWMYYAFFWTFGMYIWTNSYYWMD
FKAIWAQWPARGISANLKWYLLAQLSFWFQQILVINMEERRKDHYQMLTHHIITSTLLTS
AYIYGFYNVSNVVLCLMDIVDLLLPTAKILKYFKFELCCNITFGLFMVTWLITRHIFYPL
LCWSIYKDVPDAMAYGCYSGSTAEMISTDGYPNRFRYLFNPFLDINGPICMNRTVKWIFL
GFLLALQLLSLIWFVMVVRVAVNVLRTGNAEDTRSDGEEEEEEVEVRPVGKDALNNNPVG
VDGANADWRRASSGSASVRPRARGRIPLGDQSDRKALLGRIGCDKPT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagacgaatccacgcgatcgcaatccgtttcggagcttaatacttgtgtgtcc
accagtcaccgaactgctgccaaagacgcgacctttcgagaatggatggacgcgaatcaa
attggtatgcgtcttttctccaacttgccttggagttggactcgatggctgaccgttgct
ctgtatgcgtatctaggagtctcattgactattcttggcacccttttggctgctcataac
ctctaccccaccctccggccatacacggcgccgttcttcgaattgtcgtactaccaacct
tccgaaggggtctatgtccaaggatttgacgatgtgtactttgtcgtcagctccgccatc
acgttcaccgccgtccgagcgattgccattgaatggatcttcagaccagccgccagatat
gcgggattgaagcggaaggcttcaaatcgttttgccgagcaggcgtggatgtggatgtac
tatgcgttcttctggacgtttggaatgtatatctggacaaactcctattactggatggat
ttcaaggcaatttgggctcaatggcccgcgcggggtatctctgcaaacctgaagtggtat
ctgctggcacagctgtcattctggttccagcagatcctggttatcaacatggaagaaagg
agaaaagatcactaccagatgttgactcaccacatcatcaccagcactctcttgacgtcc
gcctatatttacggtttttataacgtttcaaacgtggtcctgtgtctgatggacattgtc
gacctgttgctgcctactgccaagattctcaagtacttcaagttcgagctttgctgcaac
atcaccttcggcctgttcatggtgacctggttgattacacgtcacattttctacccacta
ctctgctggtctatctacaaggatgtccctgatgccatggcctacggctgctactccggt
agcaccgcggaaatgatttcaaccgatgggtacccgaaccgattccgctacctttttaac
cccttcttggacatcaatggccccatctgcatgaatcgcactgtcaagtggattttcctt
ggttttcttctggcgttgcaattgctctctctcatatggttcgtgatggttgtccgcgtg
gctgtaaatgtgctccgaaccggaaatgccgaagacactcgaagcgacggcgaagaggaa
gaggaagaagtcgaagtccgacctgtgggcaaggacgcgctcaacaacaacccagtcggt
gtggacggggcgaatgccgactggcgtcgagcctcgagcggctcagctagcgtgcgacct
cgcgcgcggggacgaatcccacttggtgaccagagcgatcgcaaggccctccttggcagg
atcggatgcgacaagccgacgtag

DBGET integrated database retrieval system