KEGG   Aspergillus fumigatus: AFUA_4G06900Help
Entry
AFUA_4G06900      CDS       T01017                                 

Definition
asparagine synthetase Asn2 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
afm  Aspergillus fumigatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:afm00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 639 aa AA seqDB search
MCGIFACHHGRPHIGQGPSPGLIESALTFDCVTVTPMCRHSSPQLCAWPKLYAIVVPIGV
ETGLLRALNPSPRSRALVYRRCRFVLMPSFPLSNLHAELTADSGAQPLVNDDGTIALAVN
GEIYNHRILRKGLKKQYNFKTHSDCEVVIPLYMEHGLDAPKHLDGMFSWVLYDKKEDRVV
AARDPIGIISFYIGWSSETPGAVYFASELKSLHPVCDKIEAFPPGHVYDSKTESMTRYFQ
PKWWDPTNVPTAPVDYKVIRATLEKSVRKRLMAEVPYGVLLSGGLDSSLVASIAQRETLR
MQETAKNALVDQTGASDLVGIDDTNELSTVTTFQQLHSFSIGLPGAPDTEAALEVARFLG
TKHHAFTFTIEEGLDALSDVIYHLETYDVTTIRASTPMYLLSRKIKAMGVKMVLSGEGSD
EIFGGYLYFHAAPNKEEFHKETVRRVKNLHLADCLRANKSTSAWGLEARVPFLDKEFLEA
AMGVDPQEKMITKERIEKYILRKAFDTSDEPDTKPYLPEKILWRQKEQFSDGVGYSWIDG
LKDQAEKQITDEMMKNPKPEWGNDIPDTKEAYWYRMMFDEHFPPTCASTVERWTPTWSKQ
TDPSGRYGLQLIFGQRFSHADTSISRAIAIHAAKYEHIE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcttcgcttgtcaccatgggcggccgcacatcggacaggggccttctcca
ggtctgatcgagtccgcgctgacctttgattgtgtgacagtcaccccgatgtgcaggcat
tcaagcccacagctttgcgcatggccaaagctgtacgccatcgtggtcccgattggagtg
gaaactggtcttctgagggcactaaaccctagtcctcgctcacgagcgcttgtgtatcgt
cggtgtcggttcgtgctcatgccaagcttcccgctttcgaatttgcatgctgaactcaca
gcagactccggagcgcaacccctcgtcaacgatgatggcaccattgccctggccgtcaac
ggcgaaatctacaaccaccggatcctgagaaaggggttgaagaagcagtacaacttcaag
acacattcagattgtgaagtggtcattcctttgtatatggaacatggtcttgatgctcct
aagcatcttgatggcatgttctcttgggttctctatgacaagaaggaagaccgggtggtc
gccgctcgtgaccccatcggtatcatcagtttctatatcggatggtcctctgagacccct
ggagctgtttacttcgcctccgagttgaagtctttgcaccctgtatgcgacaagattgag
gctttcccccctggccatgtgtacgactccaagacagaatcgatgacccgctacttccag
cccaagtggtgggatcccaccaacgtccccacagctcctgttgactacaaggttatccgt
gcaactctggagaagtcggtgcgcaagcgtctgatggcggaggtgccttatggggttctt
ctgtctggtggtctcgattccagcttagtggcctccatcgcccagcgggagaccctgcgt
atgcaagagacggccaagaacgctcttgtagaccagacaggcgcgtctgatttggtcggt
attgacgatactaacgagctgtcgaccgtcaccactttccagcaattgcactccttctct
attggtctacctggcgctcctgacactgaagctgcccttgaggtggccaggttcctcggc
accaagcaccatgccttcaccttcaccattgaggaaggtctcgacgctctctccgatgtc
atctaccaccttgagacatacgatgtgacgactatccgcgcttctactcccatgtacctg
ctcagccgtaagatcaaggctatgggtgtcaagatggtcctcagtggagagggtagtgac
gagatcttcggtggttatttgtacttccatgccgctcccaacaaggaggaattccacaaa
gagactgtcagacgtgtcaaaaacttgcacttggcggattgtctcagggccaacaagtcc
acctctgcttggggactcgaggctcgtgtgcctttcctggacaaggagttcctcgaggcg
gccatgggtgttgaccctcaggagaaaatgatcacgaaagagcgcatcgagaaatacatc
ttgcgcaaagctttcgacacctcggacgagcctgacaccaagccttacctcccggagaag
attctctggcgtcagaaggagcaattcagcgacggtgtcggctacagctggattgacggc
ctgaaggatcaggccgagaagcaaatcacagatgagatgatgaagaaccccaagccggaa
tggggtaacgatatccctgacaccaaggaagcgtactggtaccgcatgatgtttgacgag
cacttccccccaacgtgcgcgtccaccgtcgagcgttggacaccgacatggtcgaaacag
accgaccccagtggaaggtacgggcttcaactcatatttggtcaacgcttttcccatgct
gatacatcaatctccagagctatcgcaatccacgctgccaagtatgagcacattgagtaa

DBGET integrated database retrieval system