KEGG   Aspergillus fumigatus: AFUA_4G07350Help
Entry
AFUA_4G07350      CDS       T01017                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AFUA_4G07350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 384 aa AA seqDB search
MGSAFSTFMGSLPPLRDLILPTPQAYTTLLNIFQYFPVFSLVQWAVSWHPAGKGSYQRSW
LNIPGKLGWFLMEIVGPANLLYILYKLPPALNITSLPLSNKLVASLYVIHYVNRAIISPF
FAAPSMSPMHASVVSMAVLFNWLNSTCLAGWLVGYHVPVLGYKTDGAVSGVPGGPSSYSA
ATHFLPCLGMVLFAAGMIGNIHSERTLFHLRREAAEKRDAAEKSDEDITQHGDEDHPTFI
QASSSSSSTDADANANAKGRKNKYDKVYVIPPARGVFRSILYPHYAFEWLEWLGFSLVGT
AVFPAAQALAYASPPLPIAPWLKPAAALAETLQVPLPLPAVVFVVNAVANMLPHARWGRK
WYVEKFGEKAVAGRGAAVPWCPWL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgcattttcgaccttcatgggatctcttccccccttgagagacctcatccta
cccactcctcaggcctacacaaccctgctcaacatattccaatattttccagtgttctcg
ctcgtccaatgggctgtctcctggcatccagctggcaaaggctcctaccagagatcctgg
ctgaacatcccgggcaaactggggtggtttctcatggagatcgtgggaccagcaaacctg
ctctacattctttacaaattgccgccagcgctcaacattacctcgctcccactatctaat
aagctcgttgcgtccctatacgtaatccactatgtcaaccgtgccatcatctcgccgttc
ttcgcggcccccagcatgtcccccatgcatgcgtccgtcgtctccatggcggtgctgttc
aactggctcaactcgacctgtctggctggttggctggtgggataccacgtcccggtgctg
gggtacaagaccgacggcgccgtctcgggcgttccgggagggccgtcgtcctactccgcc
gcaacgcacttcctgccttgcctggggatggtcctcttcgcagccggtatgataggcaac
atccactcggagcgcaccctcttccatctgcgccgcgaagcagcagagaagcgcgacgcg
gccgagaagtccgacgaggatatcacccagcatggagacgaggaccatccgacctttatc
caggcatcgtcctcgtcctcgtctactgacgcggatgccaacgccaatgccaagggcagg
aagaataagtatgacaaggtctacgtcatcccacccgcccgcggtgtcttccgttccatc
ctctacccgcattacgccttcgaatggctcgagtggctcggcttctctctcgtcggcacg
gccgtcttccccgccgctcaggcactcgcctatgcctcgccgcccttgcccatcgctccg
tggctgaagcccgctgccgcgctcgcggagacactacaggttcccctgcctcttccggcg
gtcgtgtttgttgttaatgcggtggctaatatgctgcctcatgcgcgctgggggaggaag
tggtatgtagagaagtttggggagaaggcggtcgcgggtcgaggggctgctgttccatgg
tgtccgtggctgtga

DBGET integrated database retrieval system