KEGG   Aspergillus fumigatus: AFUA_4G07700Help
Entry
AFUA_4G07700      CDS       T01017                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
afm  Aspergillus fumigatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:afm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AFUA_4G07700
Exosome [BR:afm04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFUA_4G07700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1693 aa AA seqDB search
MPNNISGDQTSHSIFIISSIHFSHSPHLHPHCLTVQVPFGAYPFAQSDHFVCVRQKLNED
DKPQVIIVNLKNNNETIKRPINADSAIMHWSRNIIALRAQGRTIQIFDLSAKQKLKSAVM
NEDVVYWKWFSETSLGLVTDASVYHWDVFDPTQNQPLKIFDRLPNLSGCQIINYRVNDDE
KWMVVVGISQQQGRVVGSMQLYSKDRGISQFIEGHAAAFASIRVEGSPLEHKLFTFAVRT
QTGAKLQIAEIDHQEPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDIVYLVTKYGFIH
LYDLETGTCIFMNRISSETIFTTAPDSESTGLVGVNRKGQVLSVSVDEGTIIQYLMENPA
MSGLAVKLASKAGLPGADHLYQQQFDNLLAQGNYSEAAKIAANSPRGFLRTPETINRFKN
APQTGQQMSVILQYFGMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMRENKLEASEEL
GDIVRPYDMNMALAIYLQANVPHKVIAGFAETGQFDKILTYSKQVGYQPDYTQLLQHIVR
VNPEKGAEFAAQLANEESGALIDLDRVVDVFLSQNMIQQATSFLLDALKDNRPEHGHLQT
RLLEMNLVNAPQVADAILGNEIFTHYDRPRISQLCENAGLIQRALENTDDPAVIKRNIVR
TDKLNPEWLMNYFGRLSVEQTLDCMDTMLEVNIRQNLQAVVQIATKFSDLLGPGQLISLF
EKYRTAEGLYYYLGSIVNLSEDPEVHFKYIEAATAMGQITEVERICRESNYYNPEKVKNF
LKEAKLTEQLPLIIVCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRTPAVVGGLLDV
DCDEAIIKNLLSTVEPSVIPIDELVSEVETRNRLKLLLPFLEATLATGNQQQAVYNALAK
IYIDSNNNPEKFLKENDMYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELINITNENAMYR
AQARYLVERADPEIWSFVLSENNLHRRPLVDQVIATAVPESTEPDKVSVAVKAFLDADLP
GELIELLEKIILEPSPFSDNGSLQNLLMLTAAKADKGRLMEYIHQLNEFSADEIAEMCIS
VGLYEEAFEIYKKVNNYIAAVNVLVENIVSIDRAQEFAERVELPDVWSKVAKAQLDGLRV
SDSIESYIRANDPSNYLEVIEIATHAGKDEELVKYLKMARKTLREPAIDTALAFCYARLD
QLPELEDFLRTTNVADVETSGDKAYAEGYHQAAKIFYTSISNWAKLATTLVHLEDYQAAV
ECARKANSVKVWKEVNQACVDKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIS
VLEAGLGLERAHMGMFTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRACEEANLWPEL
VFLYCHYDEWDNAALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTD
LLQVLTPRIDVNRVVRIFQSSDNIPLIKPFLLNVQSQNKRAVNDAINDLLIEEEDYKTLR
DSVDNYDNFDAVQLAQRLEKHDLIFFRQIAANIYRNNKRWEKSISLSKQDKLYKDAIETA
AISGKSDVVEELLRYFVDIGSRECYVGMLYACYDLIRPDVILEMSWRHGLHDFTMPYMIN
FLCEQTRTIEMLKKDNEERKAREASHKKEEDNTPILGGSRLMLTQGPATPAPVPMAYGQA
NGITPQATGFRPF
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataatatctcaggagaccagacatctcattcaattttcatcattagttccata
cacttttctcattcgcctcaccttcatcctcattgcttgactgtgcaggtaccgtttgga
gcttacccctttgcacaatcggatcatttcgtttgcgtgagacaaaaactcaatgaagat
gacaagccccaagtcattatcgtcaacctcaaaaacaacaatgaaactatcaagcggccg
atcaatgcggacagtgcgattatgcactggtccagaaacatcatcgccctcagagctcag
ggtcgaacaattcagatcttcgacctttccgcaaagcagaagctcaagtctgctgtcatg
aatgaagatgttgtctactggaagtggttcagtgaaacgagtctaggtttggtcaccgac
gcatcggtctaccactgggacgtttttgatccaacccagaaccagcctctcaaaattttt
gacagacttccaaacctgagtggttgccaaattattaactaccgtgtcaatgacgacgag
aagtggatggtcgtggtcggtatcagccaacagcagggacgtgttgtgggttcaatgcag
ctgtattccaaagatcgcgggatttctcaatttattgaaggacatgcagcagcttttgct
tcgatcagagtcgaaggctctcctttggagcacaagctgttcaccttcgcagttcgtact
cagaccggcgcgaaactgcagatcgccgagatcgatcaccaggagccgaatccgcgcttc
cagaaaaaggccgtggaagtgtacttcccgcaagaagcagttaatgatttcccggtcgct
atgcaagtctccagaaagtacgacatcgtttacctcgttaccaagtatggcttcattcat
ctttacgacctggaaaccgggacatgtatcttcatgaaccgtatctccagcgaaacaatt
ttcactacggcccccgactcagaatctacaggcctggtcggtgtcaaccgcaaaggccaa
gtcctgtcggtcagcgttgatgagggaactattatccagtacctgatggagaaccctgcc
atgtctggacttgcggtgaagctcgcgtcaaaggctggccttcctggagcggatcacctc
taccagcagcagttcgataacttgctggcgcagggcaattattctgaagctgccaagatc
gctgccaactctccccggggcttccttcgtacacccgagactattaaccgtttcaaaaat
gcgcctcaaactggccaacagatgtctgtcatcctacaatacttcggtatgctcttggac
aagggatccctcaacaagtatgagagtgttgagcttgtgcgccctgtcctgcaacagaac
aggaagcacctgctggaaaaatggatgcgtgagaataagctggaagcctccgaggaactc
ggagatatcgtccgaccatacgacatgaacatggctttggccatctatctgcaagctaat
gtacctcacaaggtcattgccgggtttgctgagactggtcaatttgacaagatcctcacc
tattcgaagcaagttggataccagccggattacactcaacttctgcagcacattgtccgc
gtcaaccccgagaagggtgccgaattcgctgctcagctggctaatgaggaaagtggcgca
ctcattgatcttgaccgcgtcgtggacgtgttcctgtcacagaacatgattcagcaggca
acctcgttcttgctcgatgctctcaaggacaataggcccgagcacggccacctgcagaca
cggttgcttgagatgaacctcgtcaacgctccccaggttgcagacgcaatccttggtaac
gagatattcacccactatgatcgtcctagaatctcccagctttgcgagaatgccggcctc
atccaacgtgctttggaaaatactgatgaccctgcggtgatcaagcggaacattgtccgt
actgacaagctgaaccctgaatggctcatgaactactttggccgcctttccgtggaacag
acccttgactgcatggacaccatgttagaggtgaacatccgccagaacttgcaggctgtt
gttcagattgcgaccaagttctcggacctccttggacccggtcaactcatcagccttttc
gagaagtaccgcaccgctgagggtctctactactatctcggaagcatcgtcaacctcagc
gaggaccccgaagttcatttcaagtatatcgaggctgctactgccatgggccagatcacc
gaggtcgagcgcatctgccgcgagagcaactactacaaccccgagaaggtcaagaatttc
ctgaaagaagccaagctgaccgagcagcttcccctcatcatcgtttgcgaccgtttcaac
ttcatccacgatttggttctctacctataccagaaccaacaatataagtcaatcgaggtc
tatgtgcagcgtgtcaacccttctcgcactccggccgtcgttggaggcttgctggatgtt
gattgtgatgaagctatcatcaagaaccttctgtcgaccgttgagccctctgttattccc
attgatgagctcgtctccgaggttgaaacaagaaacagattgaagttgctcttacctttc
ctcgaggccactctggcgactggcaatcagcaacaggccgtctacaatgctcttgccaag
atttacatcgacagcaacaacaaccccgagaagttccttaaggagaacgacatgtatgac
acgttgaccgtcggtaaatactgcgagaagcgtgatccgaacctggcctacattgcatac
aggaaaggacaaaatgacctggagcttatcaacattaccaatgagaatgccatgtaccgg
gcccaagctcgttaccttgttgagcgtgccgatcctgagatttggtcgttcgtcttgagc
gagaataatttgcaccgccgtccccttgtcgatcaggtcatcgcaacagcagtccctgaa
tcgactgaacctgacaaagtctcagttgccgtcaaggcgttcctcgatgcagatcttcct
ggcgagcttattgagctcctggaaaagatcattctcgagccctcgcccttcagcgacaat
ggtagcttgcaaaaccttctgatgctgacggcagctaaggccgacaagggacgtctgatg
gagtacattcatcagctcaatgagttcagcgctgatgagattgccgaaatgtgtatctcc
gtcgggctgtacgaagaagcgttcgagatctataagaaggtcaacaactacatcgctgcc
gtcaatgttcttgttgagaacattgtcagcattgaccgtgctcaagaatttgccgagcgc
gtggagttgccagatgtgtggagcaaagttgcaaaggcacagcttgatggtctccgcgtg
tctgactcgatcgaatcgtacatccgcgccaatgatccctcgaattacctcgaggtcatc
gagattgccactcacgccggcaaggacgaggagcttgtcaaatatctcaagatggctcgc
aagacattgcgggagccagccattgacaccgcccttgctttttgctatgctcgccttgac
caactaccggagctcgaggacttcctacgtaccaccaacgtggccgacgtcgaaacgtct
ggtgacaaggcctatgctgaaggctaccaccaggcagccaagatcttctatacgagcatc
tccaactgggccaagcttgctaccaccctggtgcacttggaagactatcaggctgcagtc
gaatgtgcacggaaggccaacagtgtcaaggtttggaaggaagtcaaccaggcctgtgtg
gacaagaaggagttccgtctcgcgcagatttgcggtctcaacctcattgtgcatgccgag
gagctgcaggatcttgtgcgccaatacgagcgcaacggctacttcgacgagttgatcagt
gttctcgaagctggtctgggactggagagggcgcacatgggcatgttcaccgagcttggc
attgctctgtccaagtaccaccctgaccgggtcatggagcacctcaagctgttctggtct
cgcatcaatatccccaagatgattcgcgcatgtgaggaagcaaatctctggccagagcta
gtgttcttgtattgtcactacgacgagtgggacaacgccgctttggcaatgatggagcgt
gccgcggatgcttgggagcaccattcattcaaggatatcattgtgaaggttgccaacctg
gagatctactatcgtgctctgaacttctatctgcaggagcagcctctgcttcttacggat
ctactccaggtcttgactcctcggatcgatgtaaaccgtgttgtacgcattttccagagc
tccgacaacattcctcttatcaagccgttcctcttgaacgtccagtctcagaacaagagg
gccgtcaatgatgccatcaacgacctcttgatcgaggaggaggattacaagactctacgt
gactcggtggacaactatgataactttgatgcggtacagctggcgcagcgtcttgagaag
catgacctcatcttcttccgacagattgcggcgaacatctaccgtaacaacaagcgctgg
gagaaatcaatttcgctttccaagcaggacaagctgtacaaggatgccattgagaccgcg
gcgatttctggcaagtcggacgtggtcgaggagcttcttcgctactttgtcgacattggc
agccgcgagtgctacgtcggcatgctgtatgcctgctacgatctcatccgccccgatgtc
atcctggagatgtcttggcgtcacggtcttcatgatttcaccatgccctacatgatcaac
ttcctctgcgagcagacacgtacgatcgagatgctgaagaaggacaatgaggaacgcaag
gcgcgggaggcgtcgcataagaaggaagaagacaacacaccaatcctgggaggctcacgg
ctcatgctgacccaagggccggcgacgcctgcccctgtaccgatggcatacggacaggct
aatggcatcaccccgcaagcgactggcttccgcccgttctag

DBGET integrated database retrieval system