KEGG   Aspergillus fumigatus: AFUA_4G08720Help
Entry
AFUA_4G08720      CDS       T01017                                 

Definition
lysophospholipase Plb1 (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
afm  Aspergillus fumigatus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:afm00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 633 aa AA seqDB search
MKTTTVACAVAGLLFSCVSGAPDPVHVEIQQRALPNAPDGYTPSTVGCPASRPTIRSAAS
LSPNETSWLETRRGKTTSAMKDFFNHVKIQDFDAAGYIDRHSSNSSDLPNIGIAVSGGGY
RALMNGAGAIKAFDSRTPNSTSAGQLGGLLQSATYLSGLSGGSWLVGSIYINNFTTISAL
QTHQKGTVWQFQNSIFEGPDGGSIQILDSATYYRDISNAVSGKSDAGYPTSITDYWGRAL
SYQMINATNGGPSYTWSSIALTDAFQKAEMPMPLVVADGRYPGELLISSNATVYEFNPWE
FGTFDPTVFGFAPLEYLGTKFNGGSVPSNESCVRGFDNVGFVMGTSSTLFNQFLLQINST
ALPDWLKSVFTDILKDIGENDEDIAQYAPNPFYHFSNTTNPSAAELELDLVDGGEDLQNI
PLHPLIQPERHVDVIFAVDSSADTTYSWPNGTALVATYERSLNSSGIANGTSFPAIPDQN
TFVNKGLNTRPTFFGCNSSNTTGPSPLIVYLPNYPYTAYSNFSTFQPDYTEQERDSTILN
GYDVVTMGNSTRDGNWSTCVGCAILSRSLERTNTNVPEICKQCFQRYCWDGSLNSTTPAG
YEPVTILDSAASGIIPSISTVAMAVVFAAWTIF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaccacagtcgcgtgcgctgtcgctggtctattattttcttgtgtgagtggt
gctccagaccccgtccatgttgaaattcaacagcgtgctctgccaaatgcccccgatgga
tacacacccagtacagttggttgtcctgccagtcgccctaccattcgcagtgccgcaagt
ttgtcgcccaacgagacatcatggctggagacgcgtcggggcaagactacttctgcgatg
aaggacttctttaatcatgtcaagattcaagacttcgacgcggcgggctacattgaccgc
cattccagtaactcgtcggatcttcccaatatcggcatcgcagtctctggtggtggctat
cgagcattgatgaacggcgcgggtgcaatcaaggcctttgatagccgtacgccgaattcc
acgagcgccggtcagttgggtggattgctgcagtcagccacctatctgtctggcctgagc
ggtggatcatggctggtgggatcaatctacatcaacaactttactaccatctctgcactc
caaacacaccaaaagggcaccgtttggcaatttcaaaattcaattttcgaaggtcccgat
gggggtagcattcagattttggattcagccacctattatagggacatcagcaatgcggtc
tccggaaagtcggatgcaggctacccgacttcaattactgactactggggccgtgctttg
tcctaccagatgatcaatgcaaccaacggtggtcccagctatacatggtcctccatcgcg
ctaaccgacgcctttcagaaggcagagatgccaatgcctttggttgttgcagatggtcgc
taccctggagaacttctcatcagcagcaatgccaccgtctacgaatttaatccttgggaa
tttggaacttttgaccccacagtttttggatttgcgcccctcgagtatctaggaaccaaa
ttcaatggcggctcagtcccaagtaatgagagctgtgtgcgtggctttgacaatgttggc
tttgtcatgggtacgtcctctactctcttcaatcaattccttcttcagatcaactcaacg
gctttgccggattggctgaaatccgtcttcaccgacatcttgaaggacattggcgagaat
gacgaggacattgctcaatatgctcctaacccattctaccacttttccaacacaaccaac
cctagtgccgctgaattggaactggatttggtggatggtggtgaagatctgcagaatata
ccactgcacccgttgattcagccagagcgacatgtcgatgtgatcttcgccgtcgattcc
tctgccgataccacgtacagctggcccaacggaactgcccttgtcgctacttatgagcgt
agcctaaattcctcaggcatcgccaacggtacttcctttcctgcaattcccgatcagaat
accttcgtcaacaagggcttgaacactcgacctacgtttttcgggtgcaatagctcaaac
accactggcccgtcgcccttgattgtatatcttccgaactacccctacacggcttactcc
aacttttctactttccagccagactataccgaacaagagcgagattctaccattctgaac
gggtatgatgtggtgacaatgggtaacagcactcgcgacggcaactggtcaacctgtgtc
ggctgtgctatcttgagtcggtctctcgaacgcaccaacactaacgtgccggaaatctgc
aaacaatgtttccagaggtattgctgggacggctctctcaacagcaccacccctgcgggt
tacgagccggtcacgattttggatagtgcagcctctgggatcattccaagtatttccact
gttgcaatggccgttgtttttgccgcctggacaattttctaa

DBGET integrated database retrieval system