KEGG   Aspergillus fumigatus: AFUA_4G08880Help
Entry
AFUA_4G08880      CDS       T01017                                 

Definition
(RefSeq) possible apospory-associated protein c
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_4G08880
Enzymes [BR:afm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AFUA_4G08880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim CARDB Glyco_hydro_65C
Motif
Other DBs
NCBI-GeneID: 3509401
NCBI-ProteinID: XP_751936
UniProt: Q4WPD6
Position
4
AA seq 318 aa AA seqDB search
MERPNKPSAIGVAASLPQPTITFRQNKIEATLPTGESVTVHLYGATVTSWKLANGREQLF
MSETAHLDGSKPIRGGIPVVFPVFGPPPPNHATSSLPQHGFARNSNWEFLGKSSSESLGK
KDSDDSVKLDFGLSHTMLSEEFRKAWPYEFGLLYSVTLSKEGLETSLQVQNKGNQNFDFQ
VLMHTYLSIDDISQIRVKNLESKTYIDKTQNATTHTENSPALEIDKETDRVYRALDPKVP
IIVASAADDKPIFSVTREGLNDVVVWNPWIEKAKGMADFSPDDAYKKMICIEAGSVASWQ
TLEAGESWEGSQSIRPRL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccgaacaagccctcagccattggtgtggctgcatcactaccccagcccacc
atcaccttccgccaaaacaagatcgaggccaccttgcccaccggcgagtcagtcaccgtt
cacttatatggagcaactgtcacctcgtggaagcttgcaaatggacgggaacagttgttt
atgagtgaaacggctcatttggatggctctaagcctatccgtggtggcattcccgttgtg
tttcctgtctttggccctcctcctcccaaccacgctacctcctccctcccacagcatggc
tttgcgcgcaactccaattgggagttcctaggcaagtcttcgtccgaatcgctaggaaag
aaggacagtgatgattcagtcaagctcgactttggtctgtctcatactatgctgagcgag
gaattccggaaggcttggccgtatgagttcggccttttgtacagtgtcaccttgagcaag
gaaggtctggaaacatccctgcaagtacagaacaagggcaatcagaatttcgacttccag
gttctgatgcacacctatctcagcattgatgatatctcgcaaatccgggttaagaacctc
gaatccaaaacctacatcgataagacccaaaacgctactacgcacactgagaactcgcct
gcattggagatcgacaaggagacagatcgtgtgtacagagcattggaccctaaggttccc
atcatcgtggcatctgccgctgacgacaagcctattttctctgttacacgcgagggattg
aacgatgtcgttgtctggaacccgtggatcgaaaaggcaaagggcatggccgatttttcc
ccggatgatgcatacaagaaaatgatttgcatcgaggctggttccgttgctagctggcag
actttggaggctggcgagtcctgggagggaagccagtcaatccgcccgagactgtag

DBGET integrated database retrieval system