KEGG   Aspergillus fumigatus: AFUA_4G09110Help
Entry
AFUA_4G09110      CDS       T01017                                 

Definition
cytochrome c peroxidase Ccp1 (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AFUA_4G09110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 366 aa AA seqDB search
MASAARSASRAFLRSTPTTSSFRPAVRAARFALPAQGFRAAGRRGYASEANSGKSSSNVF
LWAGLAVAGGAGAYLYLNGSDSVTSKTFVPGKEDYQKVYDAIARRLADETDYDDGSYGPV
LVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKIARDFLEPIKAQFPWISYS
DLWTLAGACAIQELGGPTIPWRPGRQDKDVAACTPDGRLPDASKDQRHIRDIFYRMGFND
QEIVALIGAHALGRAHPDRSGYDGPWDFSPTVFTNEFFRLLVDEKWQNRKWNGPAQFTDK
TTKTLMMLPADLALIKDKEFKKHVERYARDSDAFFKDFSDAFVKLLELGVPFTSKAEDRY
VFKTSE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggctgctagatctgcttcgcgcgccttcttgcgctccactcctactacctcc
tccttccgtcctgctgtccgcgccgctcgctttgctctcccagctcagggcttccgcgct
gctggtcgtcgtggctatgcctccgaagccaactccggcaaatcctcgtcgaacgtcttc
ctctgggctggtctcgccgtggctggtggtgccggtgcatacctctacctgaacggcagc
gattccgttacctccaagacctttgttcctggcaaggaggactaccagaaggtgtacgac
gccatcgctcgccgtcttgccgatgagaccgactatgacgatggcagctatggacctgtt
ctcgtccgtctggcatggcatgcaagtggtacctatgacaaggaaaccggcactggagga
agcaacggcgctaccatgagattcgcccccgagtccgaccacggtgccaacgctggtctc
aagattgctcgggacttcctcgagcccatcaaggcccagtttccttggatttcgtactcc
gatctctggactctggccggcgcctgcgccatccaggaactgggtggtcccaccattccc
tggcgccctggccgtcaggacaaggacgtagctgcctgcacccctgatggacgtctcccc
gacgcttccaaggaccagagacacatccgtgacatcttctaccgcatgggattcaacgac
caggagatcgttgctctgatcggggcccacgctctgggccgtgctcacccagaccgttct
ggctacgacggcccctgggacttcagccccaccgttttcaccaacgagttcttccggctg
cttgttgatgagaagtggcagaaccggaagtggaacggccccgcccagttcactgacaag
accaccaagaccctgatgatgcttcccgccgatcttgccctgatcaaggacaaggagttc
aagaagcacgtcgagcgctatgccagggacagcgatgccttcttcaaggatttttcggac
gctttcgtcaagcttctcgagcttggtgtcccctttaccagcaaggctgaggaccgctac
gtcttcaagacctctgagtaa

DBGET integrated database retrieval system