KEGG   Aspergillus fumigatus: AFUA_4G10910Help
Entry
AFUA_4G10910      CDS       T01017                                 

Definition
histone acetyltransferase
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1058 aa AA seqDB search
MPATVLPAIDDPDTRPPADMVDSDQDAEGEDETDLYEMDQQLQNAVHRAYSGENTDGDQD
ADYDEDEDAEGEPDTELNINGGNDDAEPVGAVKMPDTAGSLDNDDVASAAADAEDDPAFE
NLSDTDTPAASPSSSESEADEEWEAESNNREDAEVDTTVRSNCMWVHYSPYAHPVVILSD
AEIGDVASVVKTRITILARNLKTHRQCAREQNALDETQDVGPWRCPTCVGEKLQPSTEQN
GTNPRQPRQKKMRRELLPAHTGEKGPGFHSIFSTVDVSDDLLTSSRSLRKRKASSTDVGE
PTPGHRKLRRQSSMRSARAESRDQGFGNTDGQSPVRTRSRRTRGEEKGTCRVVLRQFGRL
VLAFRLNETKVSKILSSRSRSQLRGRRTPKPPPAVQEPLSHFAPITPAPYLSPFYSFNDR
ETDESKSKPYGGILSEADADTSRTLPTHTDRERFEIARQKAEEEWQRKLLEIENSGEAAP
HASQKLSGPPSRIKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRH
KLKCPAKHPPGDEIYRDGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFY
VMTEFDDLGCHFVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKT
GSPEKPLSDMGLVSYRNYWRLILSYQLRNQKTPISIAELSERTGMTADDVVSGLEGLRAL
VRDPITKTYALRLDCKYFEECIRNWEEKGYVQLNPDALVWTPYIMGRSNQSQFDRAPLHT
VAQREDPEEEEGEEVKKADGAVIPTASWTGHADFGGRSTVAAGPPSTQALSNTSGFHHPT
TATASSSTSAPSDPAAGIPPSRFEIYPPVQAPVFKRKPGRPFGSKSVFKAGGTPTSARTS
GRGTPRRTSTLASAATPTSNPGSVRRGRSAKLMDSPAPEPSGAKTNGLVNGEQHLQDGSE
EAQDTEPKDATSSEREAGTPNHTPNGTRSSGAAVVKVNADVSLSGGPITPKGRGVENRGK
LSRSASRKSVVEIIPDDDAPQENNIADADTDGDAVMQT
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaccgtgctgccggccatcgacgatccagatactagaccgccagcagatatg
gtggacagtgatcaggatgcagaaggggaagacgaaaccgacctctatgagatggaccag
cagctacagaatgcagttcatcgggcatactctggggagaacaccgacggggatcaggat
gccgattacgacgaagacgaagatgcagagggtgaaccggatacggagctgaacatcaac
gggggtaatgacgatgcagaaccggttggtgccgtcaagatgcctgacacagccggctct
cttgacaacgatgatgtcgcttctgcggctgccgatgcagaagatgatccagcctttgag
aatttaagtgacaccgatacacccgctgcctctccaagcagttcagaatcggaggccgat
gaggagtgggaggctgagagtaataaccgggaggacgcagaggtggataccactgtccgc
agcaattgcatgtgggttcattattctccatatgcccaccctgttgtgatcttgtctgat
gctgagattggagatgtagcttctgtggtcaagacgaggataacgatcctagcgaggaat
ttgaagactcatcgacaatgtgcacgcgaacaaaatgcactcgacgagacacaagatgtc
ggtccatggagatgccctacttgcgtcggggagaaattgcagcccagtactgagcagaat
ggtacaaacccgcgacaacctcgtcaaaagaagatgcgcagagaacttttaccggcacac
actggagagaaaggtcctggtttccactcaatcttcagcaccgtggatgtcagtgatgac
ctcttgaccagctccagatcattgcgaaaaaggaaggcctcgtcgaccgacgtgggagaa
cccacacctggacatcgaaaattgcgacggcagtcatcaatgcgatccgctcgagctgag
tcccgagaccagggctttggcaatacagacggccagtccccagtgcgtacccgttcacgg
cgaacgcgcggcgaggaaaagggtacctgccgcgtggttctgaggcaatttgggagactg
gttcttgcttttcgactcaacgagaccaaagtgtccaagattctcagttctcgaagccgg
tcacaactcagaggcagaagaacgcctaagccgcccccagcggtacaagaacctctgtcc
cattttgctcccattacacctgcaccctacctctcccccttttactcattcaacgaccgc
gaaacggacgaatcaaaatcaaagccatacggcggtattctgtcggaagcagatgcggac
acctcaagaaccctgccaacacacacagatcgtgaaaggtttgagatcgcgcgacaaaag
gccgaagaggaatggcaaaggaagcttttggaaattgaaaacagcggagaagccgcacca
cacgcttcacagaagctttctggtcctccgtcccggatcaaatacattaactttggagga
tacgagattgagacttggtatgcagctccttaccccgaagaatacagtcgaaaccgggtg
ctctacatctgcgagttttgtttgaaatacatgaattccgactatgtcgcctggcggcac
aagctgaaatgccctgcaaaacatccgccgggagatgaaatctaccgtgatggttccatc
tcgatattcgaggtcgacgggcgaaagaatccggtctactgccagaatctttgcttgctc
gctaaattgttcttgggatccaaaacgctctactacgatgtagagccgtttctgttctat
gtaatgactgaattcgacgatctgggctgccactttgtcggctatttcagcaaggagaaa
cggcccagttcggcaaacaacgtttcgtgcatcctcacactgcccatccatcaaagaaaa
ggctacgggaatttgcttatcgacttctcatacctgctgactcgtattgaaggtaagact
ggctcgccagagaaacctctctccgacatgggcctggtatcctaccgcaactactggcga
ttgatactgtcgtatcagttacggaaccagaaaactcctatcagcatcgcggaactctca
gagcgaacaggcatgacggccgatgatgtggtctctggattggaagggttacgcgccctt
gtcagggatccaattaccaagacctacgctttgcgactcgactgcaaatattttgaggag
tgtattcggaactgggaggagaaaggctacgttcagctgaacccggatgctttggtctgg
acaccatacatcatgggtcgcagcaatcagtcacaattcgaccgggctccattgcacacc
gttgcacagagagaagaccctgaagaggaggaaggcgaagaagtcaagaaggctgatggt
gcagtcattccaacggccagctggacgggacacgctgattttgggggtcgttcgactgtg
gcggctgggccaccttcaacccaagcgctctctaacaccagcggtttccatcaccccacg
actgctacagcgagttcgagtacctctgctccctccgaccctgctgcgggcattcctcct
tctcggtttgagatatatcctcctgttcaagctcctgtgttcaaacggaaaccgggacga
ccctttggtagtaagagcgtgttcaaggcgggtgggaccccaacaagtgcccggacgagc
ggtcgcggtacccctcgcagaacctcaacgttggcctcggcggcgactcctacttcgaat
ccaggtagtgttcggcggggtcggagtgccaagctgatggactcccctgctccagagccg
tccggcgcgaagactaatggacttgtaaatggcgagcagcatttgcaggatggatccgaa
gaagcgcaagacacagaacctaaggatgcaacgtcgtccgagcgagaagcaggcacccct
aatcacactcccaatggtactcgtagttcgggtgcggctgtagttaaggtaaatgccgat
gtctctctttccggcggcccgattacacccaagggaaggggagttgagaacagagggaaa
ctatcacggtcagcaagccggaaatcggtcgtggagattatcccagatgatgacgcgcct
caggaaaacaacattgctgatgcagacaccgatggcgacgcagtcatgcagacatga

DBGET integrated database retrieval system