KEGG   Aspergillus fumigatus: AFUA_4G11080Help
Entry
AFUA_4G11080      CDS       T01017                                 

Definition
acetyl-coenzyme A synthetase FacA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_4G11080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_4G11080
   00620 Pyruvate metabolism
    AFUA_4G11080
   00640 Propanoate metabolism
    AFUA_4G11080
  Energy metabolism
   00680 Methane metabolism
    AFUA_4G11080
Enzymes [BR:afm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AFUA_4G11080
Lipid biosynthesis proteins [BR:afm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AFUA_4G11080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 670 aa AA seqDB search
MSDGDVKPAKPAVVLEANDVDTFHVPKAFYEKHPSKTHLKDLDEYKKLYDESIRSPDTFW
ARMARELLTFDKDFQTTHIGSLENGDNAWFVEGRLNASFNCVDRHAIKNPNKVAIIYEAD
EPNEGRIITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIPEAVVAFLACARIGAIHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTNGRDIWWHEEVEKYPCYVAPESMSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRFFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMEHLRILGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSHVISPLGGITSTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHQVAEAAVVGIADELTGQAVNAFVSLKDGNETTEQVRKDLVM
QVRKSIGPFAAPKAVFVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVNKI
IETVHAARAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcgacgttaagcccgcaaagccggccgtggtgctcgaggccaacgatgtc
gacactttccacgtccccaaagctttctatgagaagcacccttcgaagactcatctgaaa
gatttggacgagtataagaaactatacgacgagtctatccgtagccctgacacgttctgg
gcccgcatggcccgtgagctgctcactttcgacaaagacttccaaaccacgcacatcggg
tcgctcgagaatggagacaatgcctggttcgtcgaaggtcgcttgaatgcctcgttcaac
tgcgtggatcgtcatgccatcaagaaccctaataaggtcgcgatcatctacgaggccgat
gagcctaatgagggccgcatcattacctacggcgagctcctccgcgaagtctcccgcgtt
gcctgggtcctgaagcagcggggtgtcaagaagggtgacactgtcgcgatctaccttccc
atgattcctgaagccgttgtggcttttctcgcctgtgcccgtatcggtgccattcactcc
gttgtcttcgctggtttctcctcggactccctgcgtgaccgtgtccttgatgctggatcc
aaggtcgttatcaccacggacgagggtaagcgtggtggcaaggtgattggcaccaagcgc
attgtcgatgaggccctcaagcagtgccccgatgtgaccagtgtgctggtctacaagcgc
actggtgccgaagtcccttggaccaatgggcgtgacatttggtggcatgaggaggtcgag
aagtacccctgctatgtcgctcctgagtcgatgagctccgaggaccccctcttcctcctc
tacacctctggttcgactggtaagcccaagggtgttatgcacactactgccggctacctc
cttggtgccgcgatgaccggcaagtacgtctttgacattcatgacgacgatcgcttcttc
tgcggtggtgacgttggctggatcaccggacacacctacgtcgtctatgcgcctcttctt
cttggttgctctaccgtcgttttcgaaagcactcccgcctaccccaacttctcccgctac
tgggatgtcattgagaagcacaaggtcacccagttctatgtcgcccccacagctctgcgt
ctgctgaagcgtgccggtgatgagcacatccaccacaagatggagcacctgcgtatcctg
ggctccgtcggtgaaccaattgccgctgaggtctggaagtggtactttgagaaggtcgga
aaggaggaagctcacatttgcgacacctactggcaaactgagaccggctcgcacgtcatc
agtcccctcggtggaattacttccaccaagccaggcagtgcatccttgcccttcttcggc
attgaacccgctatcatcgaccccgtctccggcgaggagatctctggcaacgatgtcgag
ggtgttcttgctttcaagcagccttggcctagcatggcccggaccgtgtggggtgcccac
aagcgctatatggacacatacctgaacgtctacaagggctactacttcactggagatggc
gctggccgtgaccacgacggatattactggattcgcggtcgtgtcgacgacgtggtcaat
gtctctggacaccgtttgtctactgctgagatcgaggccgctcttattgagcaccaccag
gttgccgaagcggctgtcgtcggtattgccgatgaactcactggccaagctgtcaacgcc
ttcgtttctctcaaggacggcaacgagaccaccgaacaagtccgcaaggatcttgtgatg
caagttcgcaagtcaatcggtccatttgccgcacccaaggcggttttcgtcgtagaagac
cttcccaagacccgcagtggcaagattatgcgccgtatcctacggaagattctgagcggt
gaagaagatagcttgggtgatacctcaaccttgtcggatccttccgtggtcaacaagatc
attgagactgttcatgctgcccgagccaagtag

DBGET integrated database retrieval system