KEGG   Aspergillus fumigatus: AFUA_4G11080Help
Entry
AFUA_4G11080      CDS       T01017                                 

Definition
acetyl-coenzyme A synthetase FacA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:afm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:afm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:afm00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:afm00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 670 aa AA seqDB search
MSDGDVKPAKPAVVLEANDVDTFHVPKAFYEKHPSKTHLKDLDEYKKLYDESIRSPDTFW
ARMARELLTFDKDFQTTHIGSLENGDNAWFVEGRLNASFNCVDRHAIKNPNKVAIIYEAD
EPNEGRIITYGELLREVSRVAWVLKQRGVKKGDTVAIYLPMIPEAVVAFLACARIGAIHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTNGRDIWWHEEVEKYPCYVAPESMSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRFFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMEHLRILGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSHVISPLGGITSTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHQVAEAAVVGIADELTGQAVNAFVSLKDGNETTEQVRKDLVM
QVRKSIGPFAAPKAVFVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVNKI
IETVHAARAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcgacgttaagcccgcaaagccggccgtggtgctcgaggccaacgatgtc
gacactttccacgtccccaaagctttctatgagaagcacccttcgaagactcatctgaaa
gatttggacgagtataagaaactatacgacgagtctatccgtagccctgacacgttctgg
gcccgcatggcccgtgagctgctcactttcgacaaagacttccaaaccacgcacatcggg
tcgctcgagaatggagacaatgcctggttcgtcgaaggtcgcttgaatgcctcgttcaac
tgcgtggatcgtcatgccatcaagaaccctaataaggtcgcgatcatctacgaggccgat
gagcctaatgagggccgcatcattacctacggcgagctcctccgcgaagtctcccgcgtt
gcctgggtcctgaagcagcggggtgtcaagaagggtgacactgtcgcgatctaccttccc
atgattcctgaagccgttgtggcttttctcgcctgtgcccgtatcggtgccattcactcc
gttgtcttcgctggtttctcctcggactccctgcgtgaccgtgtccttgatgctggatcc
aaggtcgttatcaccacggacgagggtaagcgtggtggcaaggtgattggcaccaagcgc
attgtcgatgaggccctcaagcagtgccccgatgtgaccagtgtgctggtctacaagcgc
actggtgccgaagtcccttggaccaatgggcgtgacatttggtggcatgaggaggtcgag
aagtacccctgctatgtcgctcctgagtcgatgagctccgaggaccccctcttcctcctc
tacacctctggttcgactggtaagcccaagggtgttatgcacactactgccggctacctc
cttggtgccgcgatgaccggcaagtacgtctttgacattcatgacgacgatcgcttcttc
tgcggtggtgacgttggctggatcaccggacacacctacgtcgtctatgcgcctcttctt
cttggttgctctaccgtcgttttcgaaagcactcccgcctaccccaacttctcccgctac
tgggatgtcattgagaagcacaaggtcacccagttctatgtcgcccccacagctctgcgt
ctgctgaagcgtgccggtgatgagcacatccaccacaagatggagcacctgcgtatcctg
ggctccgtcggtgaaccaattgccgctgaggtctggaagtggtactttgagaaggtcgga
aaggaggaagctcacatttgcgacacctactggcaaactgagaccggctcgcacgtcatc
agtcccctcggtggaattacttccaccaagccaggcagtgcatccttgcccttcttcggc
attgaacccgctatcatcgaccccgtctccggcgaggagatctctggcaacgatgtcgag
ggtgttcttgctttcaagcagccttggcctagcatggcccggaccgtgtggggtgcccac
aagcgctatatggacacatacctgaacgtctacaagggctactacttcactggagatggc
gctggccgtgaccacgacggatattactggattcgcggtcgtgtcgacgacgtggtcaat
gtctctggacaccgtttgtctactgctgagatcgaggccgctcttattgagcaccaccag
gttgccgaagcggctgtcgtcggtattgccgatgaactcactggccaagctgtcaacgcc
ttcgtttctctcaaggacggcaacgagaccaccgaacaagtccgcaaggatcttgtgatg
caagttcgcaagtcaatcggtccatttgccgcacccaaggcggttttcgtcgtagaagac
cttcccaagacccgcagtggcaagattatgcgccgtatcctacggaagattctgagcggt
gaagaagatagcttgggtgatacctcaaccttgtcggatccttccgtggtcaacaagatc
attgagactgttcatgctgcccgagccaagtag

DBGET integrated database retrieval system