KEGG   Aspergillus fumigatus: AFUA_4G11540Help
Entry
AFUA_4G11540      CDS       T01017                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
afm  Aspergillus fumigatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AFUA_4G11540
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AFUA_4G11540
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFUA_4G11540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 564 aa AA seqDB search
MRNPFDLTELDNAVKEQHAHIDISAYQSHDGNRSLLQNENRRGDNLKDRFIGAIDQGTTS
SRFIIFDCTGVPVAKYQTEFRQIHEHSGWHEHDPLELVDSVYTCIEEAMKTFLALGHSKS
DIEAIGITSQRETTLCWDWETGEPLHNAIAWPDTRTKNLVRELKEQEGSDELPAICGLPL
STYPSSVSLVWLLRHSPKVKQAYDEGRLAFGTVDSWLLYNLNGGPQAGRHVTDVTNASRT
MFMNLETLQYDDRLLNFFGIDKTKIRLPKILPSSDPDGYGYVRFGPLDGIPITSCLGDQS
AALVGHCAFTPGTAKNTYGTGCFLLYNVGEKPVISKHGLLATVGFQLGKNRKPVYALEGS
VAVAGSGISFLMNNLGFFRDSRKVSDLAATVPDSGGCVFVTAFSGLFAPYWIDDAKGTIF
GITQHTQRGHIARATMEAACFQTKAILDAMAKDSGHKLSELAVDGGMSNSDICMQTQADI
IQIPVERPAMHETTALGAAIAAGFAIDVWKEFSELKNMNRANRTTFTPRISPAQSARMYK
QWSKAVEMSRGWLDTSEIESEDQQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaccctttcgatctgaccgagcttgataatgctgtcaaagagcaacatgcgcac
attgatatttccgcatatcaatcgcatgacggcaaccgctcgctactgcaaaatgaaaat
cgccgaggcgacaacctgaaagaccgcttcattggtgccatcgatcagggcaccacgagt
tcacgatttattatcttcgattgcacaggtgttcctgtggccaagtatcagactgaattt
cgccagatccacgagcattcaggatggcacgaacatgatcccctcgagctcgtggattcc
gtttacacatgcattgaagaagcgatgaagactttcctggctctaggccatagcaaatca
gatattgaagccattgggattaccagtcaacgagagacaacactttgctgggattgggaa
accggcgagccgttacacaacgcgatcgcatggcctgataccagaaccaagaatctggtt
cgtgagctcaaagagcaagaggggtcggatgaactaccggctatctgcggtctacctctc
tccacatacccttcttctgtctcactagtgtggcttcttcgccatagccccaaagttaag
caggcttatgacgaaggacgacttgcttttggaactgttgactcgtggcttctgtacaac
ctcaacggcgggccgcaagctgggcgtcatgtcaccgacgttaccaatgcatccagaacg
atgttcatgaatctcgaaaccctgcaatatgatgatagactgctcaacttctttggtatc
gacaagacaaagatcaggctccccaagattcttccctcgtcagatcctgacggctatgga
tacgtccggtttggacctcttgacggaataccgatcacgagttgcttgggcgatcagtcc
gcagctttagtcggtcactgcgcctttacaccaggcacagcgaagaacacatatggcacc
ggttgcttcctgctctacaacgtcggtgagaaacccgtaatttcgaagcacggcttgctt
gccactgttggcttccaactgggtaaaaatcgaaagccggtgtacgcccttgaaggaagt
gttgccgtcgccggaagtggtatttccttcctcatgaacaacctcgggttcttccgtgat
tcgcgcaaagttagtgatcttgccgctactgttcccgacagcggaggttgcgtttttgtc
actgccttcagtggtctgtttgctccctactggattgatgatgccaagggaactatcttt
ggtatcacgcaacacacgcagcgcggacatattgctcgcgcgaccatggaagcagcctgc
ttccagacgaaggctattctcgatgccatggcaaaggacagtggacacaaattgtcggaa
ttggccgtggacggcggaatgagtaattccgacatttgcatgcagacacaagccgatatc
atccaaatccccgtcgagcgtcccgccatgcacgagaccaccgcgctgggcgccgccatc
gctgccgggttcgccattgacgtctggaaggagttcagtgagctcaagaacatgaaccgc
gccaaccgcaccaccttcacaccccgcatctcgcccgcccagagcgcacggatgtacaag
cagtggtccaaggccgtcgagatgtcccgaggctggctggacacgagcgagatcgagtcc
gaggaccaacagtaa

DBGET integrated database retrieval system