KEGG   Aspergillus fumigatus: AFUA_4G12650Help
Entry
AFUA_4G12650      CDS       T01017                                 

Definition
histone acetyltransferase (Gcn5) (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFUA_4G12650
Transcription machinery [BR:afm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AFUA_4G12650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 381 aa AA seqDB search
MRLARIPRNRLKRRALTLLKESQRIVPFPEKPAVLEERRGEIEFRVVNNDGSRDSFVVLT
GLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIVKHPLEVVGGITYRPFNSRKFAEIVFCA
ISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLTYADNYAIGYFKKQGFTKEITLDKSIWM
GYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQKEAVQAKIRAFSRSHIIHPPPREWKNGP
CKIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFTQPVNRDE
VPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDAMLIFDNCRKYNNENTPYAKSANKL
EKFMWQQIRNIPEWSVSVSLG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgcccggattcccagaaacagattaaaaaggcgcgcactgactctcctgaaa
gagagccaaaggatcgttcccttcccagaaaagcccgctgtcttagaagagcgacgaggt
gaaatcgagtttcgagtggtcaataatgatggctcgcgggatagtttcgtcgttctcacc
gggttgaagtgcatctttcagaagcagcttccaaagatgcccaaggattatatcgcacgc
ctggtctacgatcgttcgcatttgtctatcgccattgtgaagcacccattagaggttgta
ggaggcatcacctaccggccgttcaatagccgcaaatttgcggaaatcgtcttttgcgcc
atatcttcagaccagcaagtcaagggttacggtgcgcatttgatgtctcacctgaaggac
tatgtgaaagcgacctcgcccatcatgcatttcctgacttatgcggacaactatgcgatt
ggctatttcaagaagcagggattcaccaaggaaatcacgctcgacaagtctatatggatg
ggttatatcaaggattacgagggcggaaccatcatgcaatgtaccatgcttcccaagatc
cgatacttggaagcaggtcgcatgcttctgaagcagaaggaagcggtgcaagccaaaatc
agggcattcagccgttcgcatatcatccatcctccgccaagggaatggaagaacggacct
tgcaagatcgatcccctgagtatcccagccatcaaggaatccggatggtcaccggatatg
gacgaattggcgcggcaaccgcgccatgggccgaactacaatcagctcctgcacttgctc
aacgacatgcaaaaccacagtgctgcgtggccattcactcagcctgtcaaccgcgatgaa
gttcctgattactacgaagttatcaaagagccgatggacttatcgacgatggaagagaag
cacgagaaggacatgtacccgaccccgcaagatttcatcaaagatgccatgttgatcttt
gacaattgccggaaatacaacaatgagaacacaccgtatgcgaagagcgcgaataaactg
gaaaaatttatgtggcagcagattcgcaacatcccggagtggtcggtaagtgtctctctt
ggatag

DBGET integrated database retrieval system