KEGG   Aspergillus fumigatus: AFUA_4G12910Help
Entry
AFUA_4G12910      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase CreB (EC:3.1.2.15)
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 775 aa AA seqDB search
MGSFLRSFRHNGGSTAPSVGAVPAKKEPQPPPMTPLEKRLLDMGPIREDGSDKFYGMENV
RWLSYCNSILQCLYYSVPFREAVINYPTRTPIESLEAALAKSLRYPNPNAQLEAEAQAEK
QKAANAQRPGMPPNPQQKPEDKDSPEYKKKMALQTLPLLETQNNASSYGMSESLFTSLKD
IFESVVGSQSRIGIIRPQQFLEVLRRDHEMFRTAMHQDAHEFLNLLLNEVVANVEAEASK
QPPIEKSLPAPETADSVDQSSSTGSKTPNTTRWVHELFEGLLTSETQCLTCEKVSQRDEV
FLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALH
LKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHY
VAIIKTEDRGWLLFDDEMVEPVDKNYVKNFFGDKPGLACAYVLFYQETTLEAVLKEQEQE
NMDSNLAATDANDTILKQNGFPQSPLAHVHSASQIPSHEDNLRPNGLRRAPTAPQLSTHH
EHGDPESAPFSPLSPLSPLSPLSPLSQTPPVPPVPERVTTVATPPKNDALAKKERAREEK
ERKAAEKEREKAEKLRRKEQEARMKENQRREEAELKAALEMSKASKAEEDRRLSHENGKE
KQGGSLSRLKRGSKSLSHRLGKDKETRSVSSDLPPVPIPEHSTLSQTGPTSEQQQQQQQQ
QSPPNHDQPPNSPQLGKPTIREDEQVNHKDSKHERTGHGKWRSFSLRKKSFSILS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgttcctgaggagttttcgccataatgggggatctactgcgccttcggtcgga
gcggtccccgccaaaaaagaaccacagcctcccccgatgacgcctctagaaaagaggcta
ctggacatgggcccgattagggaggatggaagcgacaagttttatggcatggagaatgta
agatggttatcctactgtaattcgatattgcaatgtctctattactcggttccttttcgc
gaagcggtgatcaattatcctacgaggacgccgatagagagtttggaagccgcactggcg
aagagtctccgttatccgaacccgaacgcgcagctggaagcggaagctcaagctgagaag
cagaaagctgccaatgctcagcgacctggcatgccgccaaatccgcagcagaagcccgag
gacaaggactcgccagaatataagaagaagatggcactgcagaccctccctctcctggaa
acacagaacaacgcctcaagctacggcatgtctgagtcactctttacatctttgaaggac
attttcgagtccgtcgttgggagtcagtcccgcatcggcattatacgtccgcaacagttc
ttggaggtcctcaggcgagaccacgaaatgttcaggacggccatgcatcaagatgcacat
gaatttctgaatctattactcaacgaagttgtcgctaacgtcgaagccgaggcttccaaa
cagcctcctatagaaaaaagccttcctgcgccagagactgctgactccgtagatcaatcg
tcgagtaccggctcgaagactcccaatactactcgctgggttcacgaactatttgaaggt
ctcttgacctcagaaacgcagtgccttacatgcgaaaaggtatctcagcgtgacgaagtg
tttttggacctttccgtggatctggagcaacattcatcagtcacatcttgcttaaggaaa
ttttccgccgaggagatgctctgtgaacgaaataaattccactgtgacaactgtggtggt
cttcaagaggctgaaaagaggatgaaaatcaagcgcttgccgcgcatcctagcattacac
ctcaaacggttcaaatacacagaggaccttcagagactgcagaaattgttccatcgagtg
gtttatccatatcatctccgtctgttcaataccaccgatgacgccgaagaccccgatcgc
ctctacgagctgtatgcggtcgtggtgcatattggtggtgggccatatcacggacactat
gttgcgatcatcaaaactgaagatcgaggatggctgcttttcgatgacgagatggtcgag
ccggtggacaagaactatgtcaaaaacttttttggcgataagccgggtctagcatgtgct
tatgttctcttctaccaggaaactacccttgaggctgtcttgaaggaacaggaacaggag
aatatggactcgaatctggcggctaccgacgcaaatgacactatcttgaagcagaacggg
ttccctcagtcgcctttggcccacgtgcacagcgcttctcagatcccttcccacgaagat
aacctccggccgaatggccttaggcgagcccctaccgcgcctcagctttctactcaccac
gagcatggagaccccgagagcgctcctttcagtccgctttctccgctctctccgctttct
ccgctctctccgctttctcagacccctcctgtccctcccgttccggagagagtcaccaca
gttgcaaccccaccaaagaatgatgcgctggccaagaaggaacgggcccgggaagaaaag
gaacgaaaagcggctgagaaggaaagagaaaaggctgaaaagctgcgccgcaaggaacag
gaagcaagaatgaaggagaaccaacgccgtgaggaagctgagctaaaagccgcgctagaa
atgagcaaagcgtccaaggccgaggaagaccgtcgccttagccatgaaaacggcaaggag
aaacaaggtggtagtctgagccgattgaaacggggcagcaaaagcttgagtcacaggctc
ggcaaggacaaagagacgcggagtgtgtcgtcggatctaccgcctgtacctatcccggag
cattcaaccctttcgcagactggcccaacatcagagcaacaacagcaacaacaacaacaa
caatcacctccaaatcacgaccagccaccaaattcaccccagctcggcaagcctacgata
agagaggacgagcaagtgaaccacaaagactccaaacatgaacgtaccggacatggaaaa
tggagaagtttcagtctcagaaagaagtcgttcagcattctgtcatag

DBGET integrated database retrieval system