KEGG   Aspergillus fumigatus: AFUA_4G14650Help
Entry
AFUA_4G14650      CDS       T01017                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
afm  Aspergillus fumigatus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFUA_4G14650
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AFUA_4G14650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 350 aa AA seqDB search
MSSNTAHICVVGSLNIDFAVSTSRCPGPGETLTANSLSVTAGGKGANQAVACGRASHTSS
DASKVTVSMIGAVGADDVYYATLIRPTLEDSGVDTKYVEEKTDSRTGSATIIVEDSAHGE
NRILVVPGANHAGMDDVSKILATIQSYPQAPALIVLQGEIPRHTTLDLMRHFNQPGNQTH
MLFNPAPVFADGVPVDALSNTSVLVMNETEAVQMQASISPESAISTQTTDELKPEDLASQ
FHALANVRIVLITLGAKGVFFSTRTGRKGFVAGVRVQKVVDTTAAGDTFVGYFAAAFAEF
IATSAPLEEFDKTIEQAVRRANCAAALCVQRPGAMQSIPTASEVDGLDSR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacacggcccacatttgcgttgtcggttcgctgaatatcgactttgcggta
tcaacatcccggtgtcccgggccaggggagaccttgacggccaattccctctccgtgacg
gccggcgggaagggtgcgaaccaggccgttgcatgcggtcgagcgtcacacacctccagt
gacgcctcaaaagtcactgtgagcatgattggcgcggtgggcgccgacgacgtttactac
gcaacgctgatccgaccgacgctagaggattccggtgtagatacaaagtatgttgaagag
aagacagacagccgcactggatcagcgacaatcatcgtcgaggattcagcgcacggcgaa
aacaggatcctggtggtgccgggggccaatcatgccgggatggatgatgtgtccaagatc
ctcgccacgatccaatcctaccctcaggccccggctttgattgttctacaaggggagatc
cccagacacacgactctggacttgatgaggcatttcaaccagccagggaaccagacacat
atgctgtttaatcccgccccggtcttcgcagatggcgtcccggttgacgcgctctccaac
acctctgttctggtcatgaacgagaccgaagcggtccagatgcaggcatccatctcaccc
gagtcagcaatcagcacgcagacgacagacgaattgaagccggaagacttggcgagtcag
ttccatgctctcgccaacgtcaggattgtcctcattactcttggggcgaagggcgtgttc
ttctcgactcgcaccggcagaaagggcttcgtcgctggagtccgcgtacagaaagtggtt
gacacgacggctgctggcgacacctttgttgggtatttcgcggcggcatttgccgaattt
atcgcaacatcggcacccctggaagaattcgacaagacgattgagcaggctgtccgacgg
gcaaattgtgctgcggcgttatgtgtgcagcggccgggtgcgatgcagagtattcccacg
gcgtcagaagtcgatggtctagacagtcggtaa

DBGET integrated database retrieval system