KEGG   Aspergillus fumigatus: AFUA_5G01750Help
Entry
AFUA_5G01750      CDS       T01017                                 

Definition
MATH and UCH domain protein, putaitve (EC:3.1.2.15)
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1261 aa AA seqDB search
MDTRMDTAVTVEQLPPAVTLSVDAPSSETVTVGTELPEPTSENNITEIPENTPLDNVHPQ
SHEPSDPIPAPQPPQPELEHAYWAEIEEDTSVPDEAEMKEIESTADGDYSAYEYDYWEKN
FHPDLDDPEYRPVEKGRLTWKIKGVRGTKDAPNRSKIMRSPPAYIGGYWWTIKFFPRGNN
VGSLSIYIECSPTLPQPDKTLPETEFKVLRGPADSGLNNAAPELDMKFARTEDTASWLEQ
FTAQYPAAAASRQDPPKDTWRVSAQIGVILYNPDEPRTGWMQSSCHQFNPHNLDWGWTNF
HGPWDQIHRRQRGQRQALLRNDTLAFDAYIRIIDDPTRSLWWHASDSEPTWDSLGLTGYR
PLGDSVINHSAEVAGLASWLHLAPLCKIIQNAKVLDHYTNCDVKPKPLCDALQKFLWRLR
SRGQSLQYVDTDIITSILRNLHEYSGDVCEFWERLRRTIEFELSDTDAPKELAKIFDSPS
PDSLAVSGVDAVNTIPKDFNSRICVPAEQAKTMREGLSWYLTQKPGRWALPPVLHVELYR
HKLDKAARQWRLVYNKVDLDEELDLTPYLVDGQCGSYVLYGYIVHRGRRTSGKFFSILRP
GGPGTRWLAFDDGSDNRVECLTRKTALGPHLGLDESQKVDHKTGHDVAIAVMYIRGDVVS
EFLPGPQGPWDVSPSLKEYYETGIYPLSSMSAGKPAEKEIQVEVYAPPQYDKLPSLFDSY
DLMSQAKAANKVMYMTVPRSENIVELRKKIALWASAGSETQASPENIRLWQIGHTRDRFG
PTLAFERISDLKSTLDLPVPVARLWMQVVSDDEAKYFAIRDPRDTVVAQRKTEEAVVERA
GSESSDDRQYTPEVRSGGAEASSSGNVTESDFSNGDRVSVEQPPPRASDSEVSESSSQET
PDSSEIQPSNASTEDDAAIAAIIAQDVQQMDIQLAEEAQQSPIRAEQSSNDTTQSEPAEQ
RAASPAPEAMSSTSEEPDVPLPVEHVYYFIQIFDVEAQALRTVGSFFSRKEEKIKTALRK
HLKWPMTKDFSIWQRVDGTTVTTMSSVGTFDVYVPDGTCFIVGDKFSKEKRTELSVAGLF
SSPDRLIHYLFAAERNHPTRAFTGTKTIDASFNSEYYSGEFLKGYYHGKGKHISDSAATY
VGDFVFGKRHGSGAMEYPTGDTYDGDWYEDQCHGQGTFVEKKTGNKYVGGYKDGKRHGKG
ISYWEVADEEMDLCQICYSEEQDALFYDCGHVCACVTCARQVDICPICRKNIISVVKIYR
T
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atggatactcgcatggataccgcggttaccgtggagcagctcccccccgcggtcacgctg
agtgtcgatgctccctcgtcagaaacagtcactgttggcacagagcttccggagcctacc
agcgaaaacaacattacagagatccctgaaaatactcctctagataacgtccatccgcag
tcacatgaaccatcagatccaattcctgcaccccaaccgccgcaacctgagctcgagcat
gcatactgggccgaaatcgaggaggacacgtcggtacctgatgaggcggagatgaaggaa
atcgagtcgacagcggatggggactatagtgcttacgagtacgattactgggagaagaac
ttccacccagatctcgacgatccagagtatcggcccgttgaaaaaggccgcctgacatgg
aagatcaagggcgtgcgagggaccaaagacgcgcccaaccgcagcaagatcatgcgttcc
cctcctgcttacatcggcggttactggtggacaatcaagtttttcccacgtggtaacaac
gtgggttccctgagcatctacatcgaatgctccccgaccttgcctcagcctgacaagaca
ctgccagagaccgagttcaaagtgttgcggggaccggccgattcggggctcaacaacgcc
gctcccgagctggacatgaagtttgctcgaactgaagacacggcaagctggcttgagcag
ttcacggcacagtatcccgcagcggctgccagcaggcaagaccctccaaaggacacctgg
agagtgtcggcacagattggtgtcattttgtacaacccggacgagcctcgcacgggttgg
atgcagtcctcgtgccaccaattcaacccgcacaaccttgactggggctggactaatttc
cacggcccgtgggaccagattcaccgccgacagcggggccagcgccaggcgctactccgc
aatgacacgctggcgttcgatgcatatatccgcatcattgacgaccccacccggtctctg
tggtggcatgctagcgattctgaaccgacctgggacagtctgggcttgactggatatcgg
ccgctgggtgattctgtcatcaatcacagtgccgaggttgcaggactggcctcctggctg
catctcgcaccgctgtgcaagataatccagaatgccaaggtcttggaccattacacaaac
tgcgatgtgaagcccaaaccgctctgcgatgcgctacagaagttcctctggcgtcttcgc
tctcgtggtcagtccctgcaatatgtggatacggatattatcacttccatcctgcgcaat
ctgcatgaatactcgggcgatgtctgcgagttctgggagcgcctgcgtcggaccatcgag
tttgaattgtcggacaccgatgctccgaaggagctggccaaaatcttcgacagcccctcg
ccggactcccttgccgtttctggagtggacgcggtaaacaccatcccaaaggatttcaac
tcacgcatttgtgtgcctgccgaacaggccaaaacgatgcgcgaagggttgagctggtac
ctgactcagaaacccggtcgttgggcattgccacctgttctccatgtcgaactgtaccgc
cataagttggacaaggcggcgcgtcagtggcgcctggtctacaacaaggtcgatcttgat
gaggaattggatctgactccatacctggttgacggccagtgtggaagctatgtcctctat
ggctacattgtccaccgcggacggcgcacgtcgggcaaattcttcagcattcttcgtccc
ggtgggcccggaaccaggtggcttgcattcgatgatggcagcgataatcgtgttgaatgc
ctcacacgcaagacagccttgggaccgcatcttggtctggacgagtctcagaaagtagac
cacaagactggtcatgatgtcgcgattgccgtcatgtatatccgaggcgatgttgtctcg
gagtttctccctggtcctcagggtccgtgggacgtctcaccgtcgctcaaggaatactat
gagaccggcatctaccctctatcatccatgtccgctggaaagcccgcagagaaggaaatc
caggtagaggtctatgctccgccacagtatgacaagttgccgagtctgtttgactcctac
gatttgatgtcccaagccaaggcggccaacaaagtgatgtatatgactgttccccgctcc
gagaatattgtcgagctgcgcaagaagatcgctctctgggcctctgcgggcagcgagacc
caggccagtcccgagaatatccgtctctggcagattggacatactcgtgatcgattcgga
ccaacacttgcgttcgagcggatctcggatctgaaatcgaccctcgatctgcctgttcca
gttgctcggttgtggatgcaggtcgtctctgatgatgaggcaaaatactttgctatcaga
gatccccgcgacactgtagtcgcccagcgcaagacagaagaggcagtagtcgaacgcgcc
ggttctgaatcttcggacgacaggcaatatactcctgaagttcgaagtggaggggctgag
gccagctcatctggtaacgtgaccgaaagtgatttcagcaatggtgacagggtgtcggtg
gaacagcctccgccacgggcgagtgattccgaggtctccgagagctctagtcaagagact
cccgactcctctgagattcaacccagcaacgcgagtactgaagatgatgcggccatagcg
gcaatcatcgcacaggatgtccagcagatggacatccagctggctgaggaggctcaacaa
tcacctattcgggctgagcagtcctccaatgacactacccaaagcgaaccagcagagcaa
cgagctgcttctccagctcccgaggctatgtctagcacttcggaagagcccgatgtccca
ctgcccgtcgagcacgtttattacttcattcaaattttcgacgtcgaggcacaagcgttg
cgtacggtgggctccttcttctcccgaaaggaggagaaaatcaagaccgctctgcggaag
cacttgaagtggccgatgacgaaggatttttcgatctggcagcgggttgatggcaccact
gtgacaaccatgtccagcgtaggaactttcgacgtctatgtgccagatggcacatgtttc
attgtcggtgacaaattcagcaaggagaagcgcacggagctcagcgttgcgggcctattc
tccagtcccgatcggctgatccactacctctttgcagcggaacggaatcatcccactcgg
gccttcaccggcacaaagaccatcgatgcctccttcaacagcgaatactacagtggcgag
ttcctgaagggttactaccacggcaagggcaagcacatctccgactcggctgccacatac
gtcggcgactttgtgttcggcaagcgccatggcagtggtgccatggagtaccccaccggg
gatacctacgatggagactggtacgaggaccagtgccacggccagggaaccttcgtcgag
aagaagacaggcaacaaatatgtcggcggctacaaggacggcaagcgacacggcaagggc
atcagctactgggaagtcgcggacgaagagatggatctgtgccagatctgctacagtgag
gagcaggacgccctgttctatgactgtggccatgtctgcgcctgtgtgacttgtgcccgc
caggtcgatatctgtcctatctgtcggaagaacatcatcagtgtagtcaagatttatagg
acgtaa

DBGET integrated database retrieval system