KEGG   Aspergillus fumigatus: AFUA_5G01830Help
Entry
AFUA_5G01830      CDS       T01017                                 

Definition
extracellular endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_5G01830
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AFUA_5G01830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 575 aa AA seqDB search
MQNQAMKGLRVAALVALFRSAWAQAGNCPGTFTSISAADFVSRVHPGWNLGNTLDAVPNE
GSWNNAPVQASTFDTVKSAGFNSVRLPVTWAYHFTGDSPDWTVDPAWLQRVSDVLDMITS
RGLYAIVNVHHDSWIWADVTQSGANLTMIEEKFYRLWYQIGTKLGCKSNMVAFESINEPP
VNNAQDAAELNKLNEIFLQAINKAGGFNSKRVVNLVGGGQDSIKTSQWFKAPTGFSNPYA
IQFHYYSPYDFIFGAWGKTIWGSDSDKTALTNDFKLLRNNFTNVPIILGEYDASPTNTEP
AARWKYTDLLAHAAAQYNFAAILWDNGLDHLDRTTGNWRDPTSLQIITKTKSSTKNSLPD
STTDASATSQSSSAYIFHQVGTPVTSQTLPFIFNGNTLRSIRDSSGTTLKQGTDYSVSGS
NLVFTASYLSKHFSASTKPGIIADLTLVFSSGASPVVQLVQWQTPTLGSTSVAASSVSGD
LSIPITWGGVPKVAAVKALTTSGKYLVDDWTQVLGPLQQARTTYSNQWKFEGSNVILTSG
AIDAVKSVGQTTVFTFEFYPRVAGGVNTVNFTVTV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccaagccatgaaggggttgcgcgttgctgcccttgtggcacttttcagaagt
gcatgggcccaagcaggcaattgtccgggaacctttacgtccatatctgctgctgacttc
gtttctcgtgtccatcccgggtggaatttgggcaatactcttgacgctgttcctaatgag
ggctcctggaacaatgctccagttcaagcatccacgtttgataccgtcaagtcggctggg
ttcaacagtgtacgacttccagttacatgggcataccacttcactggcgactcgccggac
tggacagtggatccagcttggctgcagagagtctctgacgttttggatatgattacatcc
cgcggcctgtacgcaatcgtcaacgttcaccatgactcgtggatctgggccgatgtcact
cagtcgggagccaaccttacgatgattgaggagaaattctatcgactctggtatcagatt
ggcaccaagttgggttgcaagtcgaacatggttgcctttgagtcgattaatgagccaccc
gtcaacaatgcccaggatgctgctgagctcaacaaactgaatgagatcttccttcaggct
attaataaagctggaggattcaactccaagcgagttgtcaatctggttggtggtggccag
gatagcatcaagacttcgcagtggttcaaggctcctaccggcttctctaacccttatgcc
attcagtttcactactatagtccttatgacttcattttcggcgcatggggcaagaccatc
tggggctcggactctgacaagactgcccttaccaatgatttcaagttgcttcgaaacaac
ttcaccaatgtacccatcatcctcggagagtacgacgcatctccgacgaacaccgagcca
gccgcacgctggaagtacactgaccttttagctcacgctgctgcccagtacaactttgct
gctattctctgggacaacggcctcgaccaccttgaccggacaaccggtaactggcgtgac
cctacctccctccaaatcatcaccaaaacaaagtcctccaccaaaaacagcttgcccgac
agcaccacagacgcttccgcgacaagccagtcgtcttccgcctatatcttccaccaggtc
ggaacaccagtcacgagccagaccctcccatttatcttcaatggcaatacactccggtcc
atcagggactccagcggtactaccctgaagcaaggaacagactattccgtctccggctcc
aacctcgttttcacggcgtcgtacctctcgaagcacttctccgcgtctacaaagcctggc
atcatcgccgacctcaccctcgtgttctcctctggcgcctcccccgttgtccagctcgtg
caatggcagacgccaacactgggttctacgtccgttgccgcatcgtccgtctccggtgat
ctctccatccccattacatggggtggcgtccctaaggtcgcggccgtcaaagctctgact
accagtggcaaatacctcgttgatgactggacacaggtgctgggcccgttgcaacaggcg
agaacgacctacagcaaccagtggaagttcgagggctcgaatgtcattttaacgtctggg
gctattgatgctgtgaaatctgtgggtcagactacggtgtttacgtttgagttctatcct
cgtgtggctggtggtgtgaatacggtcaacttcaccgtgacggtttag

DBGET integrated database retrieval system