KEGG   Aspergillus fumigatus: AFUA_5G02130Help
Entry
AFUA_5G02130      CDS       T01017                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
afm  Aspergillus fumigatus
Pathway
afm00052  Galactose metabolism
afm00561  Glycerolipid metabolism
afm00600  Sphingolipid metabolism
afm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_5G02130
  Lipid metabolism
   00561 Glycerolipid metabolism
    AFUA_5G02130
   00600 Sphingolipid metabolism
    AFUA_5G02130
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AFUA_5G02130
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AFUA_5G02130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 3505626
NCBI-ProteinID: XP_748129
UniProt: Q4WE86
Position
5
AA seq 426 aa AA seqDB search
MSRSKTRQGKLPALGWNTWNAFGCDIDATKIMTAANEVVNLGLKDLGYEYINIDDCWSVK
SGRDASTQRIIPDPDKFPDGISGVADQIHDLGLKIGIYSSAGLTTCAGYPASLGYEDIDA
QTFAEWGIDYLKYDNCGVPSNWTDTYTYCVPDPGSKATNGTCPDNKNPAPAGYDWRTSLT
AERYRRMRDALVSVDRTILYSLCEWGQANVNDWGNETGNSWRTTGDITPSWPRIAAIANE
NSFLMNHVDFWGYPDPDMLEVGNGNLTLAENRAHFALWAAMKSPLIIGTALDSISQDHLA
ILSNKILLKFHQDPVIGRPAQPYKWGYNPDWTFDPAHPAEYWSGASSVLGGTLVLMLNSE
DTTQRRTAVWKEVPELKDVLGRQGKRRIGFRVTDVWTGKDLGCVRDHYSVELESHDVAAL
VVGRAC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggtctaaaactcgacagggaaaactacccgctctaggctggaacacgtggaat
gcgttcggctgcgacattgatgcgaccaagatcatgactgccgcgaacgaggtcgtcaat
ctgggtctgaaggatctaggatatgagtatatcaatatcgatgattgctggtctgtcaaa
agcggacgagacgcgagcacgcagcgaatcatcccggaccctgacaagttccctgatggt
atctctggcgtagcggaccagatacatgatctggggctgaaaattggaatctatagcagt
gccgggctcacgacctgcgccgggtaccctgccagtctgggatacgaagacatcgatgct
cagacgttcgcggaatggggcatagattacctgaagtacgacaactgcggcgtcccctca
aactggacagacacgtacacatactgcgtccccgacccgggcagtaaagccacaaacggg
acctgtcccgataacaagaatcccgcgccggcgggttatgactggcgcacgtcgttgaca
gcggagcggtacaggcggatgcgcgatgcgttggtcagcgtcgaccgcacaatcctgtac
tcgctatgtgaatggggccaagcgaatgtgaacgactggggcaacgagacaggcaattcc
tggcgaacgactggggatatcacgccatcctggcctcgtatcgccgccatcgccaatgaa
aactccttcctgatgaaccatgttgatttctggggttatccggacccggacatgctggag
gtcggcaacggcaatctcacactagcagagaaccgagcgcactttgcgctctgggcggca
atgaagtcgcccttgatcattgggactgctctcgactccattagccaggaccacctcgct
atcctctctaacaagattctcctaaagttccaccaggacccggtgatcggccgtcctgcg
cagccatacaaatgggggtacaatcctgactggacgtttgaccccgctcatcccgcagag
tactggtccggcgcatcgtcagtgctgggtggcacgctggtgctgatgctgaattcggaa
gatacgacgcagaggcgaacggctgtgtggaaggaggtccctgagctgaaagatgtgctc
ggtagacagggaaaacggcgcattggatttcgtgtgacggatgtgtggaccgggaaggat
ctgggttgcgtgagagatcattacagtgtggaattagagagtcatgatgtggccgcgtta
gttgttgggagagcgtgctag

DBGET integrated database retrieval system