KEGG   Aspergillus fumigatus: AFUA_5G02480Help
Entry
AFUA_5G02480      CDS       T01017                                 

Definition
glycogen synthase Gsy1 (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_5G02480
Enzymes [BR:afm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AFUA_5G02480
Glycosyltransferases [BR:afm01003]
 Polysaccharide
  Storage polysaccharide
   AFUA_5G02480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 713 aa AA seqDB search
MDSEDTGPDPPKRDVRNHILFEIATEVANRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLN
RASAAVEVEELTPSNPRMVETMNSMKERGIGMVYGRWLIEGAPRVLLIDTGTGYKYLDEW
KGDLWNIAGIPSPASDTETNEAIVFGYLVAWFLGEFIAHERRRAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAEAGKRGIYHRYCIERAAAH
SADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFAAVHEFQNLHSQSKEKINDFVRG
HFYGHNDFDLDNTLYVFTAGRYEFRNKGVDMFIEGLARLNHRLKASGSKTTVVAFIIMPA
QTSSLTVEALKGQAVVKSLRDTIEMIEKSIGKRMYERCLAWKEGDNMPDEKDLITSQDRV
LLRRRLFAMKRHGLPPIVTHNMINDHEDPILNQIRRVELFNYPTDRVKVIFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRMKGVDESVNQLTDFMFNFTQKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPSSFDGPEDYFDVIGGTEQKLSRPLSVPGSPRDRSGVMTPGDFATIQEV
KEGLDTEDYIAWRLPNSEEEEPDDHYFPLTLRTKKSSDRPSSPLDSIPVNGGR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaggatactggtcccgaccctcccaagagagatgtgcgcaaccacatcctc
tttgagattgctactgaagtcgccaaccgagtcggtggtatatactccgtgctgaaatct
aaagctccggtcactacagctgaatatggcgatcggtacaccctgatcgggcctttgaac
cgggcctccgcagccgtggaggtggaggagctgactccctcgaacccccgcatggtggag
actatgaactccatgaaggagcgtggcattggcatggtgtatggtcgctggctgattgaa
ggtgcccctcgggttctcctcatcgatacaggaactggatacaagtacctggatgagtgg
aagggcgacctctggaatatcgccggtattccgtctcccgcgtcggatacggagaccaat
gaggccattgtcttcggttacctggtagcgtggtttttgggagaatttatcgctcacgaa
cgccggcgtgcagtagtcgctcatttccacgaatggcttgccggtgtcgccctgcctctg
accaagaagaggcacatggatctaaccactatcttcacgactcatgcgactttgcttggt
cggtatctttgcgccggatctgtcgacttttacaacaatctccagcatttcgatgtggac
gccgaggctggcaagagaggcatctatcataggtactgcattgagagagccgccgcacac
agcgcagacgtcttcactacagtctcacacatcacggcatttgaaagtgagcatctgctc
aagcgcaaaccggacggggtgcttcccaatggattgaatgtcaagaaattcgcggcggtg
catgagttccagaacttgcactcccagtccaaagagaagatcaacgacttcgttcgcggt
cacttctatggccacaatgactttgatctggacaacactctctacgtcttcacggcaggt
cggtatgaattccggaacaagggagtggatatgttcatcgagggcctggctcgtcttaat
catcgcctgaaagccagcgggtccaagacgaccgtggtggcctttatcatcatgccagcc
cagacctcgtcgctgactgtggaggccctcaagggtcaagctgtcgtcaagtccttgcga
gacacaatcgagatgatcgaaaagagtatcggaaaacggatgtatgagcgttgcctagcc
tggaaagaaggcgacaacatgcccgacgagaaggatttgattacaagccaagaccgtgtg
ctgctgcgtcggagacttttcgccatgaagcggcacggattgcctccgattgtgacgcac
aacatgatcaatgaccatgaggatccgattctcaaccaaatccgtcgcgttgagcttttc
aactacccgacggaccgcgtcaaggtcatcttccatccggagttcctgaactcctccaac
cctgttctgcctctggactacgacgactttgtccgtggtacgcatctgggagtcttccca
tcgtactacgaaccctggggttacacgcctgcggaatgtaccgtgatgggcgtgccaagc
atcaccaccaacttgtccggtttcggctgctacatggaagaattgattgaaaactcctcc
gactatggaatttacattgtggaccggcgcatgaagggcgttgatgaatctgtcaatcag
ctgactgacttcatgttcaattttacccagaagagccgacgacagcgcattaaccagagg
aaccgcacggaacgtttgagtgatctgctcgattggaagcgtatgggtttggaatatgtc
aaggctcgacagctggctctaagaagagcctacccttcatccttcgatggtcccgaagac
tatttcgacgtcattggaggaacagagcagaagctctcgcgtccattgtcagtccccggg
tctccacgggatcgatctggagtgatgactccgggtgattttgctaccattcaggaagtc
aaagagggcctggacactgaggactatatcgcatggcgtcttcctaatagcgaagaggaa
gagccggatgatcattacttcccgctcactttacggacgaagaagtcttcggaccgacct
tcgtcgccgctggatagcatccccgttaacggtggccgttga

DBGET integrated database retrieval system