KEGG   Aspergillus fumigatus: AFUA_5G02620Help
Entry
AFUA_5G02620      CDS       T01017                                 

Definition
P450 family sporulation-specific N-formyltyrosine oxidase Dit2 (EC:1.14.-.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFUA_5G02620
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFUA_5G02620
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFUA_5G02620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 538 aa AA seqDB search
MTWMRVMPRCQNRTYKRPRGPPLSIHPLEFFQAKKVEKTAKAKMILYYLASIPLAIICYL
AWYLHVPWDLPSLPRIPFYVSILGLWSSMGQDEIYERWLRKPLEAHGAVLIWFAGRWSIL
VTRPDLLTDMFRNEDLYAKAGSQKKIPWSVIATLVGDNIINSHGDTWKLYTGIMKPGLQK
KNFDTAPLLLKSRRFVDEILAEQNSAGRGTGILVNTFVQQWAVDVMGMSFLDLDLQSLEK
PHGTVRLEAIQSVIKLMLFRPLFFNFPDLDQFAWLIKSRQRAYEIMHEFGDTLMATVLGR
IDSDREKGIKPAEEMVVHMLVDAYRDGRLTEKQFKDNLKIVFLTAHENAQQLVNSMFWEI
GKNNEVQTRLRAEILSTNTTTPTSEVVNALPYLTAVVYELLRLYPPVSQLINRVTVRPAM
LGNEIPIPAGTFVGWNAYGVHVNPAIWGPDANEFKPERWGRTVGEMHARFRRETVRGTYI
PFNAHSRKCLGQGFVLLQMKILLFEVLRRIEWTVDPGYRLKMTPVSYFLESGRKSTDA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacttggatgcgagtgatgcctcgttgccaaaatcgtacatacaagagaccgcgagga
ccaccactatcgatccatccactcgagttctttcaagcaaaaaaagtcgaaaagacagcc
aaagcaaagatgattctctattacctcgcctcaatccccctcgccatcatctgctatctg
gcatggtacctccacgtcccgtgggacctgccctcactcccgcgaatccccttctacgtt
tccatcctcggtctctggagctcgatgggccaagacgagatctacgagcgctggctgcgc
aaaccccttgaagcccacggggccgtcctaatctggttcgccggccgatggagcattctc
gtcacgcgcccagacctgctaacagacatgtttcggaacgaggacctctacgcaaaagca
ggcagccagaagaagatcccctggtcggtgatcgcaacactggtcggcgacaacatcatc
aattcgcacggcgacacctggaagctgtacacggggatcatgaagcccgggctgcagaag
aagaactttgataccgcgccgctgctgctcaagtcgcggcggttcgtggatgagattctg
gcggagcagaactctgccggtcgcggcacgggcatcctggtgaacacgtttgtccagcag
tgggcggtggatgtcatggggatgagctttctggatctggacctgcagagcctggagaag
ccgcacggcacggtgcgcctcgaagccatccagtctgtgatcaagctgatgctgttccgg
ccgctgttcttcaattttcccgatctagaccaattcgcgtggctgatcaagtcgcggcag
cgtgcgtacgagatcatgcacgagttcggggatacactcatggcgacagtgctgggtcgc
atcgacagcgaccgcgagaaaggcatcaagcccgccgaggagatggtcgtgcatatgctg
gtcgatgcctaccgcgacggcagactgaccgagaagcagttcaaggataatctcaagatt
gtgtttctgacggcgcacgagaacgcccagcagctggttaactcgatgttttgggagatt
ggcaagaataacgaagtccaaacacgcctccgcgccgaaatcctctcgacaaacaccaca
acgccaacctccgaagttgtcaacgccctcccctatctcacagccgtcgtctacgagctt
ctgcgtctctaccctcccgtctcgcagctcatcaaccgcgtcacggtccgccccgccatg
ctcggtaacgagatccccattcctgcaggcacgtttgtcggctggaatgcatacggagtg
cacgtcaacccggcgatctggggtcccgacgcaaacgaattcaagccggagcgatggggc
cggacggtgggtgagatgcatgcgcggtttcgccgggagacggtgcgcggcacgtatatc
cctttcaatgcgcattcgaggaagtgtctcgggcaggggtttgtgttgctgcaaatgaag
attctgctgtttgaggtactgagacggatcgaatggacggtggacccgggctatcggttg
aagatgacgccagtaagttattttctggaatccgggaggaagagtactgatgcatga

DBGET integrated database retrieval system