KEGG   Aspergillus fumigatus: AFUA_5G02930Help
Entry
AFUA_5G02930      CDS       T01017                                 

Definition
lysophospholipase (EC:3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AFUA_5G02930
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     AFUA_5G02930
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AFUA_5G02930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 560 aa AA seqDB search
MTAAEATIPELLEEQADSVPESRVLIIMTGGTICMKQSPSGFVPARGFQEQCLARVPTFN
DGSSSTMMDVVVNAAREIRPHPSLRTPQTLYGRRVRYTVFEFEELLDSSSIDAKGWTEIA
RTIERNYTLFDAFVVLHGTDSLAYTCSALSFMLQNLGKTVVLTGAQAPMLELQNDATDNL
LGSLVVAGHFVIPEVCLYFNNKLFRGNRSCKVAASDFAAFDSPNFPPLAVTTSMRTNVNW
ELVNRPKNIEHFSIQTNLDTTHVACLRIFPGIKPEMVDAVLKLEGLRGLVLETFGAGNAP
HGQDNAMTNVLADAIKRGIVIVNVTQCLTGSVSPVYAPGMSLSRAGVVAGLDMTTEAALT
KMSYLLALPDSTPESVAKAMSVSLRGELTEVSQPMFRHPDGALPERVQTLTMLGYAIAQG
DFERVQEIFKIEHHWILNDADYSGNTPIHLAATSPSVEILRFLLLQGGSVHIRNRNGRTP
LFLAANAGLSEHVLLLRKSGAHLHSDERQAAELLARRRPAVWGLAGIGPREVSDREMEEE
NESLLGRREIPSRMVSGSAP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcagaggcaaccattcccgagctgctcgaggagcaagcggactcagtccct
gagtccagggtcttgattattatgaccggagggacgatctgcatgaaacagtcaccctca
gggtttgtgccggctcggggattccaggaacagtgcctggcccgcgtgcctactttcaac
gatggctcctcctccacgatgatggacgttgtggtcaatgcagcgagagagatcagaccg
catccgagtctacgaacgccgcagacgttgtacggccgccgggtgcgatacacggtgttt
gagttcgaggagctactggatagcagctccatcgacgccaagggttggaccgagatcgca
cggacgatcgagcggaactacacactcttcgatgcctttgttgtgctccacggcaccgac
agcttagcatatacgtgctccgcgctgagcttcatgctccagaatctcggcaagacggtc
gttcttacgggagctcaggctccgatgctagagctacagaatgacgctacggataacctc
ctgggctccttggttgtggcgggccacttcgtgatcccggaggtgtgtctgtatttcaac
aacaagctcttcaggggcaaccgatcgtgcaaggtggcggccagtgactttgcggcattc
gactcgcccaacttcccgccgcttgcggtgacgacgtcgatgcgcaccaatgtcaactgg
gaacttgtgaatcggccaaagaatatcgaacactttagcatccagacaaatctggacacc
acgcacgtcgcgtgtcttcgcatctttcctggcatcaaaccggagatggtggacgccgtg
ctgaagctcgaaggactccgcggattagtgctggagacctttggtgcgggaaacgcaccg
cacggccaagataacgccatgactaacgtgcttgccgacgcgatcaagagagggatcgtc
atcgtcaatgtcactcaatgcctgaccggcagcgtgagccccgtctatgcgccgggaatg
agtctttcccgcgcaggcgtcgttgcgggtctcgatatgacgacagaagccgctctgacc
aagatgtcctaccttctggctcttccggactccacgcccgagtctgtggccaaggccatg
tcagtctcgcttcgcggagagttgactgaagtgtcgcagccgatgttccgccaccctgac
ggtgcacttccggagcgggtgcaaacgctcaccatgttgggatatgcgatcgcacaggga
gacttcgaacgcgtgcaggagatcttcaagatcgagcatcactggatcttgaacgatgca
gattactccggaaacaccccaatccatcttgccgcaacctctccgtccgtcgagattctc
cgcttccttctgctgcagggggggtcagtgcatatccgaaaccgcaacgggcgcacaccg
ctgttcctcgccgccaatgccgggctatcagagcacgtcctcttgctgcgcaagtcaggc
gcgcatctgcattctgatgagcggcaagcagccgaactccttgcgcggcgcaggcccgcc
gtttggggtctggccggcattgggccgagggaagttagcgatcgcgagatggaggaagag
aacgagtcgctcctgggacgacgagagattcccagtcggatggtctctggctctgctcct
taa

DBGET integrated database retrieval system