KEGG   Aspergillus fumigatus: AFUA_5G03180Help
Entry
AFUA_5G03180      CDS       T01017                                 

Definition
translation initiation factor eIF4E3
Orthology
K03259  
translation initiation factor 4E
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_5G03180
Translation factors [BR:afm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AFUA_5G03180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 347 aa AA seqDB search
MDNANLWTRRANSAKLSLSMTGTDGKDGGAKVDLPRGHTSKRFGPDSSHGGRSNPFNALS
PLSGGVSSPSTNASSAFGLGSGAFASFGTPKTPGTNASDLNSSKALGEKRETASEQDSAA
DVKAKASASSLTGPKEHALKSTWVIWYRPPTPKYSDYEKSTIPLASISSVESFWSIYTHL
KRPSLLPTVSDYHIFKKGIRPVWEDDANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQFA
EASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETIKRLLAFPADTNIVWKSHDDSIA
QRSAIDQARQEKAAGNAGHHHHHLAGDRRRPTANDESMGDKGKAAAS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaaacttgtggactcgcagggccaattccgccaaattgtctctgtccatg
acaggaaccgacggaaaggacggtggcgcgaaagtcgatcttccccgcggacacacatca
aagcgtttcggcccggatagctcgcacggcggtcgatcgaatcccttcaatgcattatcc
cccctctcgggtggcgtttcttctccttccactaacgcatcctccgcatttggcttgggt
tcgggcgcattcgcgtcctttggtactcccaagacgcctggcaccaatgcgtcagacctg
aattcgtccaaagcgctgggggagaagcgagagacggcttcggagcaggattcggcagcg
gatgtcaaggccaaggcttcagcctcctccttgactggcccgaaagaacatgctctgaag
tctacgtgggtgatctggtaccgtcccccgacacccaagtactctgactatgagaagtca
accattcctcttgcatctatatcctcggtcgaaagtttctggtcgatatatacacatctc
aaacgcccatcgcttctccccaccgtctccgactatcacatttttaagaaaggtatccgt
cctgtatgggaagacgatgccaacaagaagggtggaaagtggattgttcggctgaagaag
ggagttgctgaccggtattgggaggatcttctgttggccatgattggtgaccagtttgcg
gaggctagtgatgaggtctgtggcgctgttctcagtgtaaggagcggagaggatgtgttg
agtgtctggacccggattgacggtgggcgcaatatcaagatcagggagacgatcaagcgg
cttcttgccttccctgccgacaccaacattgtatggaagagccacgacgacagtattgct
cagcgctccgcaattgaccaggctcgccaggagaaggcggccggaaacgcgggccatcat
caccaccacctcgcgggagaccgacgaagacctacagcgaatgacgagtccatgggagat
aaaggaaaagcggcggcgtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system