KEGG   Aspergillus fumigatus: AFUA_5G03250Help
Entry
AFUA_5G03250      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase (HAUSP) (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1123 aa AA seqDB search
MDNVADNEMLVDEYEQYHNDRTDDVVVSRSGSEEPEPEPLADDFTAMMARILPKDPDLET
ADEAYHTWHIQDWRKLKKKEHGPIFQCGGFPWRVLFFPYGNHVDYASFYLEHAWEKEPPE
NWYACVQFALVLWNVNDPSIYVSHVATHRFNADEGDWGFTRFCELRRLFNMPWEGRGVPL
VQNDEAKITAYVRVVKDPTGVLWHSFQNYDSKKETGMVGLKNQGATCYLNSLLQSLYFTN
AFRKAVYQIPTEAEATRDNSAWTLQRLFYNLQTSESSVSTTELTASFGWESRQIFEQQDV
QELSRKLMERLEEKMKATPVEKALPGLFVGKTKTYISCINVDYESSRVEDFWDIQLNVRG
NKTLDDSFKDYIQVETLEGENKYDAGSPYGLQDAKKGVIFESFPPVLHLHLKRFEYDINR
DAMMKINDRHAFPMEFDATPYLSDAADKSEPWIYQLHGVLVHSGDLNAGHYYAFLKPTKD
GHWFKFDDDRVTRATDKEVLEENYGGEYELSNGAAGVRQPHTRGLSTKRSMNAYMLVYIR
KTRLDDVLLPITKDDIPSHIEKRLVEERAELLRRKKEREEAHLYINVGVLSDESYTSHHG
FDLTSADLPAGDPALPKQYRILRAKKVGEFVEQLAEERGLNANQIRLWVMVNRQNKTTRP
DQAIKDPEMTVEEAYSRFGTKGNPFKVWMEVGQPSADGTISWPDSSTSVLVFLKNFDVPS
QTLSGVGTVYVRKNQKVAELAPTILEKMNWPAGTEFMLFEEIKHNMIDVMKPKQTFQQSE
IQDGDIITFQRTVKESDLPSTALYTEARQYYDYLLNRINITFAPIKATDGDEFTLTLSRK
MTYDQFSKKVGEHLNVESTHLRFAPVLASTGKPKQFIKRNPNQANQTLYHILSGQVSGYG
YSMHRQDALYYEVLETSLSDYESKTTLKVTLLTEGIVKEQLFEVLVPRDGTFADLLAGLQ
KKANLEDDVVREMRIFEAHSGKIYKEYQEDAKIAGINEYVTLYAERIPEEELQMQAGERT
INAFNFDREPSRPHGIPFKFVMKPGEIFKETKERLSKRTGIKGKQFEKIKFAVVPKSLYS
NPRYLDDDDILSDIVGESDDMLGLDHVNKSRSFWSRSESFFIR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgttgcggataatgagatgctcgtcgatgaatatgagcagtatcacaatgac
aggacagatgatgtcgtggtttctcgctccggatcagaggagccggagccagagcccctt
gcagatgactttacggcaatgatggcgcgcatactccctaaggatccggacctggaaacc
gcggacgaggcataccacacatggcacatccaggattggcggaagttgaaaaagaaggaa
catggaccaatatttcagtgtgggggattcccatggcgggtactcttcttcccttacggt
aatcatgtcgattatgcgtcgttctatttggagcatgcctgggaaaaagagcctccggaa
aactggtatgcatgcgtccagtttgctctcgtattgtggaacgtcaatgacccatcaatc
tacgtgtctcatgtcgctacgcatcgttttaacgccgacgagggcgattggggctttacc
aggttctgtgagctgcgcaggcttttcaacatgccgtgggaaggccgtggagtccccctg
gtgcagaatgatgaagctaaaatcactgcctacgtgcgtgttgtgaaggacccgacaggg
gtactctggcacagtttccaaaattacgactcgaagaaggagactggcatggtggggttg
aaaaaccagggcgcaacgtgctacctcaactccctgctgcaatccctgtatttcacaaat
gctttccgcaaggccgtgtaccaaattccaacagaggcagaagcgacgcgagataacagt
gcctggacactccagaggctcttctacaaccttcaaacgagcgaaagctctgtctcgaca
acagagctgaccgcatcatttggctgggaatcgcggcaaatcttcgaacagcaagatgtc
caggaactttccagaaagcttatggaaagattggaagagaagatgaaagcgaccccagta
gagaaggcattgcctgggcttttcgtggggaagacgaagacttacatttcatgtatcaat
gtcgactacgaatcgtcgcgtgttgaagacttttgggatatccagctcaatgtcaggggc
aacaagacacttgacgacagtttcaaggactacattcaggtggaaacccttgagggcgag
aacaagtacgatgcaggctctccctacggcttgcaagacgccaagaaaggtgtcatcttc
gagagctttcctcctgtgcttcatctgcacctgaaacgtttcgaatatgacattaatcgc
gatgcaatgatgaagattaatgaccgtcacgcgttccccatggaattcgacgcgactcca
tatctatccgatgcggccgacaaatcggaaccgtggatctatcagctgcacggggttcta
gttcacagcggtgatctaaacgcaggccattactacgcattcttgaagcctaccaaggac
ggccattggttcaaatttgatgacgaccgtgtgacccgggccactgacaaggaggtactt
gaggagaactatggtggtgaatatgaactatccaatggtgcggccggcgtccggcaacca
catacacggggtctgtcgaccaaacggtcaatgaatgcctacatgttggtctatattcgg
aaaacacgcctggatgatgtccttcttccgattacaaaggatgatattccctctcacatt
gagaagcgtttagtagaggagcgggcagagcttctccgcagaaagaaggagagagaagag
gctcacctgtatatcaatgtgggagttctatcggacgagtcgtatacgtcacatcatgga
ttcgatctgacgagcgcggacctaccggccggcgatcctgctctgccgaaacagtatagg
attcttcgggctaagaaagttggcgagttcgtagagcagcttgcggaagaacggggtcta
aacgcaaaccaaatcaggctgtgggtgatggtgaaccgtcaaaacaagacgactcgcccg
gaccaagccatcaaagacccagaaatgacggtggaagaggcctacagcagatttggtacc
aaagggaacccgttcaaagtctggatggaagttgggcaaccatctgcggacggaaccatc
tcgtggcctgacagcagcacttctgttctcgtctttttaaagaactttgacgtcccctct
cagactctttctggagtcggtaccgtatacgtccgcaagaaccagaaagtcgcagaactc
gccccaacaattctcgagaaaatgaactggcctgccgggacagagtttatgctttttgag
gaaatcaagcacaacatgatcgatgtgatgaagccgaagcagactttccagcagtctgag
attcaagacggcgacataatcacgttccaacgcacagtcaaagaatccgacttaccatcc
actgcactgtacacggaagcgaggcaatactatgactacctgttgaacaggataaatatc
acattcgctcccatcaaagcgactgatggcgacgagttcactctcactctgagccgaaag
atgacatacgatcagttctcgaagaaggtcggcgagcacctcaacgtggaatcaactcac
ctgcgtttcgcccccgttcttgctagtaccggaaagcccaagcagttcattaaacgcaat
cctaaccaggccaaccaaacgctgtaccacatccttagtgggcaggtcagtggctacggt
tatagtatgcatcgccaagatgcactatactacgaagtccttgagactagtctcagtgat
tacgagtcgaaaactacactgaaagtaacgttactcaccgagggcattgtgaaagagcaa
ctgtttgaagtcctagtgcctcgggacggcacctttgcggaccttctggcgggtctgcag
aaaaaggcaaaccttgaggatgatgtggttcgagaaatgcggatctttgaggctcacagc
ggcaaaatttacaaggagtaccaagaagatgctaagatcgctggcatcaatgagtacgtg
actttatacgctgagaggatacccgaggaagagcttcagatgcaggccggcgaacggaca
atcaatgcattcaactttgaccgagagccaagcaggccgcatggtatccctttcaagttt
gtcatgaaacctggcgagatcttcaaggaaacaaaagagagactttccaaacgaaccggc
atcaaaggcaaacaatttgagaagatcaaatttgctgttgttcccaagtctttgtattct
aacccacggtatcttgatgatgatgacatcctttccgacattgttggcgaatccgacgat
atgctgggactggaccatgtaaataaaagccggagcttttggagcaggagcgagtccttt
ttcattcgatag

DBGET integrated database retrieval system