KEGG   Aspergillus fumigatus: AFUA_5G06140Help
Entry
AFUA_5G06140      CDS       T01017                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFUA_5G06140
Transfer RNA biogenesis [BR:afm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AFUA_5G06140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 574 aa AA seqDB search
MATLTMTMPPPSKPKNGNEKLPPENERYMRACSDIANVLIQEYEAQRDSTKPRKDINLNK
LRGQIAKKHRLATQPPLTAIIAAVPEQYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCP
HIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGH
SVDKVEYIVMGGTFMSLPPDYRESFIAQLHNALSGYQTDNVDEAVQAGEMSNIKCVGITI
ETRPDYCLDTHLSDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFK
VVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNY
TPNALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRD
VRTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSATH
TFRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSRKI
SVISGVGVRSYYARLGYTLDGPYMSKMLDPIEDE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccttaccatgacaatgccgccaccatccaaacccaagaacggcaacgagaaa
ctcccgccagaaaatgaacgttatatgcgagcttgctctgatatcgcaaatgtgctcatt
caggagtatgaagcgcagagggattcaaccaaacctaggaaagatatcaatctcaacaag
ctgcgcggccaaatcgcgaagaagcatcgcctggctacgcaacctcccttgacggctatc
atcgctgctgtgccggaacaatacaagaaatatatcttacccaagctcatcgcgaagccc
attcggacgtcgtcggggattgccgttgttgccgtgatgagcaaacctcaccgttgtccg
catattgcctacaccggtaacatttgtgtttactgccctggcggacccgattcggatttt
gagtattcgacacaatcatatactggctacgagccgacatcgatgcgcgcgatccgagca
cggtacgatccgtttgaacaagcgagaggtcgggttgatcagatcaagtcactcggccat
agtgtggacaaggtggaatatattgtcatgggtggcacatttatgtctcttccgccggat
tatagagaatccttcatcgctcagcttcacaatgcgctgagtgggtaccagacggacaat
gttgacgaggctgttcaggccggcgaaatgagcaatataaaatgcgtgggtattacgatc
gagacgcggccggattactgtctggatactcatctgagtgatatgcttcgatatgggtgc
acgcgattggaaatcggtgtccaaagtttgtatgaagatgttgcgcgggatacgaatcga
ggccatactgtcgctgcagtggcagagacattcaagctcgccaaggacgctgggtttaaa
gtcgttagtcacatgatgccagatctaccgaatgtcggcatggaacgggatcttttccag
tttcaggaatattttgaaaacccagccttccgtacggacggtctgaagatttatccgaca
ctggtcattcggggtacaggtctgtatgagctttggagaacgggtcgctacaagaactac
actcccaacgcgctggtagatcttgtcgctcgaatccttgcgctcgtaccgccgtggacg
cgtatctaccgggtgcagcgagatattcccatgcccctggtcacttccggcgtggagaat
ggtaaccttcgagaactggctttggcacgcatgaaagactttggtacaacatgtcgtgat
gtgcgcactcgcgaagttggtattaacgaagtaaaaaacaaaatccgcccctcgcaagtg
gagctcatccgccgagactatactgccaacggtggttgggaaacattcctcgcctatgaa
gatcctaagcaggatattctcatcggcttactgcgcctgcgaaagtgcagcgcgactcac
actttccgtccggaattcacgggccagcagacgagtattgtgcgagagctccacgtatat
ggctctgcggtaccgctccacggccgcgatccgcggaagttccagcaccgaggatttgga
accttgctaatggaggaggccgagcggatcgctcgagaagaacacggaagtcgaaagatc
agtgtcatctcgggagtcggtgtccgcagctactatgctcgtcttgggtacacacttgac
ggtccttacatgtccaagatgctcgatccaattgaagacgaataa

DBGET integrated database retrieval system