KEGG   Aspergillus fumigatus: AFUA_5G06990Help
Entry
AFUA_5G06990      CDS       T01017                                 

Definition
(RefSeq) O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
afm  Aspergillus fumigatus
Pathway
afm00350  Tyrosine metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFUA_5G06990
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     AFUA_5G06990
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFUA_5G06990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI
Motif
Other DBs
NCBI-GeneID: 3510992
NCBI-ProteinID: XP_753935
UniProt: Q4WU29
Position
5
AA seq 266 aa AA seqDB search
MADQSQRHPRPGEHESGKELKLLHFIYEQPDIDEIRGNPQRVLDLIHKFEEKYRFMNVGA
AKGKIVTDLIAELKPHTMIELGGYVGYSAILFGDAVRRAGGKRYFSLELNPEYAAIANML
IELAGLRDFVRIIVGRSDKSLHKLFTSGEVKQIELMFLDHYKPAYTTDLMLCEQLGMIVP
NVTVLAADNVLRPGNPPYLEYVRSTVEQKREAAKKGPIKSYNKEGIPQRTVQSFLGEDDK
PSFEVLGNPNLVYKSTLHQPEGLQVR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaaagtcaacgtcaccctcggcccggagagcacgagagcggaaaagagctt
aagctcctgcacttcatctacgaacagcccgacatcgatgagatcagaggcaacccgcaa
cgggttctggatctcatccacaagttcgaagagaaatatcgtttcatgaatgtgggagct
gccaaaggcaagatcgtcaccgatctcattgctgaactcaagccacatacaatgatcgaa
ctgggcggctacgtaggctactcggccatactgttcggcgatgccgtccggcgagctggc
ggcaagcgctatttcagtctggaactgaacccggaatatgccgccatcgccaacatgctg
atcgagctggctggcctgcgggactttgtccgcattatcgtcggtcgaagtgacaagtcg
ctgcacaagctgttcaccagcggcgaggtcaagcagatcgagctcatgttcctcgatcac
tacaagcccgcgtacaccacggatctgatgctttgcgaacagctcggcatgattgttccc
aatgtcacggttctggccgcggataatgtcttgcggcccggtaacccaccgtatctggag
tatgtccgcagcacggtggagcagaagcgcgaggccgctaagaaggggccgatcaagagt
tataacaaagaaggtatcccgcagcggacggtccagtctttcctgggtgaggatgataag
cccagttttgaggtgctcgggaacccgaatctagtgtacaaaagcacgctacatcagccg
gaggggttgcaagtgcgttga

DBGET integrated database retrieval system