KEGG   Aspergillus fumigatus: AFUA_5G07030Help
Entry
AFUA_5G07030      CDS       T01017                                 

Definition
cyclin Ccl1
Orthology
K06634  
cyclin H
Organism
afm  Aspergillus fumigatus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AFUA_5G07030
  Replication and repair
   03420 Nucleotide excision repair
    AFUA_5G07030
Transcription machinery [BR:afm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AFUA_5G07030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 433 aa AA seqDB search
MFEDDIYRTSSQYKLWSFTEASLRSLRENTNAVASQRVRAALRRAREARQSANPSAAGTA
TAGTTADGKGADENDIDCLTPEEETELVRFYCEKAVELADTYKPPLPTTVRATAIQYIRR
FYLSNSPMTYSPKTIMPCALFLATKTDNFYMSLRQFAEKVPGDTTAEDIIAPEFLIMQSL
RFTFDVRHPFRGLEGGVMELQAMAEGLGQPAPHLPHQTSEDLRRGLLAVPPPPNAPQSSS
ITDRIARAHTTTRELLKTAAQMTDAYFLYTPSQIWLAAFMLADRPLAEYYLDTKLGGPTA
ESANAQAGNPLYELRVKLLRTLNQCAALLQSYKPLNSDPEQMKNLKRIGKKFYYCQNPEK
ISLAGQKRIPAAAAAAAASAGEGATSESEVERQAKKRKLEREQRDREARDIFGGELVAQR
VKEGQVGQQQHPS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacgacatctatcggacctcatcacagtataaactttggtctttcacagag
gcctccttacggtcgctaagggagaacacaaatgctgttgctagccaacgagtccgagcg
gctctgcggagagcacgggaggcgcgacagtcagccaacccgtcggctgcggggactgct
acagcaggaactactgcagatggcaagggagcggacgaaaatgacattgactgtttgaca
ccagaagaagagacggaattagtgaggttttattgtgaaaaggccgtagagctggcggac
acatataagccaccgttgccgacaacagtgcgggccactgcgattcagtacatccgtcga
ttctacctcagcaactcgccaatgacctactcgcctaaaacaatcatgccctgcgctctc
ttccttgcaaccaagaccgacaatttctacatgtccttgcgccagttcgccgaaaaagtc
ccaggagacacaacggcagaagacatcattgctcccgagttcctcatcatgcaaagtctc
cgcttcaccttcgacgtccgccaccccttccgcggccttgaaggcggcgtcatggaactc
caagccatggccgaaggcctaggccaacccgcacctcacctccctcaccagacctcagaa
gacctacgccgcggactcctcgccgtcccacccccaccaaacgctccccagtcctcctca
atcacagaccgcatcgcccgcgcgcacaccaccacccgcgaactcctcaaaaccgccgcc
caaatgaccgacgcctacttcctatacacaccctcacagatctggctagcagcgttcatg
ctcgccgatcgccccctggccgaatactacctcgacacaaaacttggcgggccaaccgct
gagagtgccaatgcacaagcagggaacccactctacgagctccgcgtgaaactcctccgc
acactcaatcagtgcgctgccctcctgcaatcatacaaacccctcaactctgaccccgag
caaatgaagaacctcaaacgcatcgggaagaagttctactactgccagaacccggagaag
atctccctggctggacagaagcggattcctgctgctgctgccgccgccgccgcgtcggca
ggcgagggcgccacatcggaaagtgaagtcgagcggcaggcgaagaagcggaagctggaa
cgggagcaaagagatcgggaggcgagagatatctttggcggggagctggtggcgcaacgg
gtcaaggagggccaggttggccagcagcaacatccgtcgtag

DBGET integrated database retrieval system