KEGG   Aspergillus fumigatus: AFUA_5G10060Help
Entry
AFUA_5G10060      CDS       T01017                                 

Definition
cytochrome b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afm  Aspergillus fumigatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_5G10060
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AFUA_5G10060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 471 aa AA seqDB search
MMTEFTVADVAGHKTRDDLWVIIHGKVYDLTKYIRDHPGGADVLLDVAGTDATAAYEDVG
HSEDADDIMQTYLVGTLKDATRFVRKSAVRVIQPTSVPVAKDNSSSRVGKVAAAGSVAGL
LSLLYYVPPRHGSLQLPHALYQLQAYLPSLHRLLPSSMTGMRLPQGGFANGFAAAALLSA
IITGIVGMQVSKLTKIDSGFTRYPPRIKSKPSPKADPHSIPGFLNPKDYKTLPLVQKALL
APNVYRFVFQLPSATDIVGLPVGQHVAIKATVDGQTVTRSYTPTSNNLDRGYLELVIKCY
PDGLLTGQYLANLQVGDKVHFRGPKGAMKYQRNLCKKIGMIAGGTGITPMYQLIRAICED
DKDTTEISLVYANRSEGDILLREELEAFARRYPKQFQVYYMLDVPPENWTYGKGYVTPAV
MAARLPKPAADTKIFLCGPPGMINAAKKGLVSLGFEAPGAVGKMTDQIFCF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaatttaccgtcgcagacgtcgcaggtcataagacccgtgatgatctctgg
gtgatcatccacggcaaagtttacgatctcaccaagtacattcgggatcatccaggcggc
gcagatgtgctgctggatgttgccggtaccgatgccaccgccgcgtacgaggacgtcgga
cactcggaggatgcggacgatatcatgcagacgtatctggtgggcacgttaaaagatgcg
actcggtttgttcgcaagtccgctgtgcgtgttattcagccgacctccgtgccagtagcg
aaagacaacagctcgtctcgggttggcaaagttgctgctgccggctcagtggctggtctg
ctcagcttgctatactacgtgcctccccgtcatggatcattgcaactcccacacgccctc
taccaactgcaggcatatctccctagtctgcaccgcctgctgccgtcctccatgaccggc
atgcgcctgccacaggggggcttcgccaatggattcgcagccgcagccctactctccgcg
atcatcaccggcatcgtggggatgcaagtgtcgaaactgaccaagatcgactccggcttt
actcgatacccccctcgtatcaagagcaagccgagtcccaaggcggatcctcacagcatt
cccggcttcctcaaccccaaggactacaagacgctccctctggtgcagaaagccctcctc
gcgcccaacgtctaccgattcgtcttccaactgccatcagccacagatatcgtcggcctc
ccggtcggccagcacgtcgccataaaagccaccgtcgatggccaaaccgtcacacgatcc
tacacgccaacctccaacaacctcgaccgcggctacctcgagctcgtcatcaaatgctac
ccggacggccttctgaccggccagtacctcgccaacctgcaagtcggcgacaaagtgcac
ttccgcggccccaaaggcgcaatgaagtaccagcgcaacctgtgcaagaaaatcggcatg
atcgccggcggcacaggcatcacccccatgtatcagctgatccgggcaatctgcgaggac
gacaaagataccaccgagatcagcctggtgtatgccaaccgcagcgagggggatattctg
ttgcgcgaggagctggaggcgtttgcgcgcaggtacccgaagcagtttcaggtgtactat
atgctcgatgttccgccggagaactggacgtatggcaaggggtatgtgacgcctgcggtg
atggccgcgaggctgcctaagccggcggctgatacgaagatcttcctgtgtgggccgcca
gggatgatcaatgcggcgaagaaggggcttgtctcgctgggcttcgaggcgccgggcgct
gtgggcaagatgactgatcagattttttgtttctag

DBGET integrated database retrieval system